KEGG   Saccharomyces cerevisiae (budding yeast): YPL266WHelp
Entry
YPL266W           CDS       T00005                                 

Gene name
DIM1, CDH1
Definition
(RefSeq) putative dimethyladenosine transferase
  KO
K14191  
18S rRNA (adenine1779-N6/adenine1780-N6)-dimethyltransferase [EC:2.1.1.183]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.183  18S rRNA (adenine1779-N6/adenine1780-N6)-dimethyltransferase
     YPL266W (DIM1)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic Type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    YPL266W (DIM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
SGD: 
UniProt: 
Position
XVI:39121..40077
Genome map
AA seq 318 aa AA seqDB search
MGKAAKKKYSGATSSKQVSAEKHLSSVFKFNTDLGQHILKNPLVAQGIVDKAQIRPSDVV
LEVGPGTGNLTVRILEQAKNVVAVEMDPRMAAELTKRVRGTPVEKKLEIMLGDFMKTELP
YFDICISNTPYQISSPLVFKLINQPRPPRVSILMFQREFALRLLARPGDSLYCRLSANVQ
MWANVTHIMKVGKNNFRPPPQVESSVVRLEIKNPRPQVDYNEWDGLLRIVFVRKNRTISA
GFKSTTVMDILEKNYKTFLAMNNEMVDDTKGSMHDVVKEKIDTVLKETDLGDKRAGKCDQ
NDFLRLLYAFHQVGIHFS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaggctgcgaaaaagaagtactccggagcaacttcgtccaaacaagtctctgcc
gagaaacatttgagttcagtatttaaattcaacacagatctaggtcagcatattttgaaa
aatcctttggtggcgcaaggtattgttgataaggcacagattagaccctcagatgttgtt
ttggaggttggtcctggtacaggtaacctaactgtaaggatcctcgaacaagcaaaaaac
gtagtggcagtagaaatggatcccagaatggctgcagaattaactaagagggtacgtggc
acacctgtggagaaaaagttagaaatcatgcttggagattttatgaagactgaattacca
tactttgatatctgtattagtaacactccttaccagatctcatcgcctctggttttcaaa
ttaattaaccaaccaagaccaccaagagtatctattcttatgtttcaaagagagtttgct
ttaagattactggcaagaccaggtgactcattatactgtagattatccgccaatgtacaa
atgtgggctaatgttacacacatcatgaaagtgggtaagaataacttcagaccgccacca
caagtggaatccagcgttgttagactagagattaaaaatccaagaccgcaagtggattac
aacgaatgggatggtttgttgagaatcgtctttgtgaggaaaaacagaacgatttcagct
ggcttcaaatcgaccaccgtgatggacattctggagaagaattataagacatttttggcg
atgaacaacgaaatggtggatgatacaaagggttctatgcacgatgtcgtcaaggaaaag
attgacacagttctgaaggagaccgacttaggcgacaaaagagcgggtaaatgtgatcaa
aatgatttcctaaggctattatatgcttttcaccaggttggtatccatttttcatga

DBGET integrated database retrieval system