KEGG   Saccharomyces cerevisiae (budding yeast): YPL270WHelp
Entry
YPL270W           CDS       T00005                                 

Gene name
MDL2
Definition
ATP-binding cassette permease MDL2
Orthology
K02021  
putative ABC transport system ATP-binding protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XVI:30482..32803
Genome map
AA seq 773 aa AA seqDB search
MLNGRLPLLRLGICRNMLSRPRLAKLPSIRFRSLVTPSSSQLIPLSRLCLRSPAVGKSLI
LQSFRCNSSKTVPETSLPSASPISKGSARSAHAKEQSKTDDYKDIIRLFMLAKRDWKLLL
TAILLLTISCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLI
GCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR
SMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ
EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSL
LGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR
LFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIV
GPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRD
NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARAL
IKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGH
DGSVVEMGKFKELYANPTSALSQLLNEKAAPGPSDQQLQIEKVIEKEDLNESKEHDDQKK
DDNDDNDNNHDNDSNNQSPETKDNNSDDIEKSVEHLLKDAAKEANPIKITPQP
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatggtcgtttaccacttttgcggctgggcatatgcagaaacatgctgtcccgt
ccccgactggctaaactgccatctataaggtttcggtctttggtcaccccttcttcatcg
cagctcattcctctcagtcggttgtgtttaaggtcacctgcagttggaaaatcactaatt
ttacaaagttttagatgtaattcatccaaaacagttccagaaacttctctgccttcagcc
tctcccatatctaaaggatcagcaaggtcggcacatgcaaaggagcaatctaaaactgat
gactataaagatataataaggttatttatgttggcgaaacgggattggaaactgcttctt
acagccatacttcttttaaccatatcatgttccataggcatgtctattcctaaagtcata
ggtattgtccttgacacacttaagacgtcatctggatcagatttttttgatttgaagata
ccgattttttctttgcctttatatgagtttctttccttttttactgttgctttactgatt
ggttgtgctgctaattttggtagatttatattattgaggatactaagtgagcgtgttgtt
gcacgcctaagggcaaatgtcattaaaaaaacgcttcatcaagacgcagaattcttcgac
aaccataaagttggggatttaatttctcgtttaggatctgatgcttatgttgtttcaaga
tcaatgacccagaaggtctcggatggggtcaaagccctaatttgtggggttgttggcgtg
gggatgatgtgttctttgtcacctcaactatcaatattgttactattcttcactccacct
gttctttttagtgcctcagtgttcgggaagcaaattagaaacacctctaaagaccttcaa
gaagctactggtcaattgactagagtcgctgaagaacaactctctggtatcaagacggtt
cagtcgtttgttgctgaaggtaatgaattgtctaggtataacgttgcaattagagatatt
tttcaggtgggaaaaactgcggcatttacaaacgcaaagttttttactacaactagtctc
ttaggtgacctaagttttttaaccgtccttgcgtatggctcctatcttgttttacaatca
cagctctccattggtgatctgactgcatttatgctgtacacagaatatacggggaatgcg
gtattcggcctttctaccttctattcggaaattatgcagggtgctggggccgcttccagg
ttgtttgaattaacagataggaaaccttccatttcaccgactgtgggacacaagtataaa
ccagatcgtggtgttatcgaatttaaagatgtttcatttagctaccctacaaggccttct
gttcaaatattcaagaatttaaattttaaaattgcgccaggatcgagtgtttgtattgtg
ggcccttcaggtcgtggtaaatctacaattgcactcttactgctaagatattataatccc
actactgggactattacgatagataaccaagatatctctaaattgaattgtaaatcccta
agaaggcatattggtatcgttcagcaagagccggtactgatgtcaggtactattagggat
aatatcacttatgggttgacatataccccaacaaaggaagaaatcaggtcagtagcaaag
cagtgcttttgccataactttatcacaaaatttccgaacacatacgatacggtaattggt
cctcacggcaccttactaagtggaggacaaaagcagcgtattgcgattgcaagggctcta
atcaaaaagccaactattttgattcttgatgaagctacatcagctttagatgttgaaagt
gaaggagccattaactatacgtttggtcaactaatgaaatcaaaatcgatgactattgtt
agcatcgcgcacaggctaagtacgatcagaagatcagagaatgttattgtccttggccat
gatggatcagtggtagaaatgggcaaattcaaagaattgtatgcgaatccaacaagtgct
ttatcgcaattacttaatgagaaagcggctcctgggccatctgaccaacaactgcaaata
gagaaggtcatcgaaaaggaagatttgaatgagagtaaggagcatgatgaccagaaaaag
gacgataatgacgataatgataataatcatgataacgacagcaataaccagtctccagag
acgaaagacaataattcagatgatattgaaaaatctgtcgaacatctcctgaaagacgcg
gcaaaggaggctaatccaattaagatcacaccacaaccgtga

DBGET integrated database retrieval system