KEGG   Saccharomyces cerevisiae (budding yeast): YPR006CHelp
Entry
YPR006C           CDS       T00005                                 

Gene name
ICL2
Definition
methylisocitrate lyase ICL2 (EC:4.1.3.30)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YPR006C (ICL2)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    YPR006C (ICL2)
Enzymes [BR:sce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     YPR006C (ICL2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XVI:complement(567269..568996)
Genome map
AA seq 575 aa AA seqDB search
MITMINNKTFNRKTTGTLKKLVLSSDKSLRRSFNGASSTKDFVFSESSKVEEWWESARFK
NISRPYSATDVVKHRGSLPANTSIYPSSYQARKLFNLLEENFKNGTPLHTLGVIDPVQMS
QLARCRNIKVAYISGWACSSTLVGSTNEVSPDFGDYPYDTVPNQVERIFKAQQLHDRKAF
LEASIKGSTPVDYLKPIIADADMGHGGPTTVMKVAKLFAEKGAAGIHLEDQMVGGKRCGH
LSGAVLVPTATHLMRLISTRFQWDIMGTENLVIARTDSCNGKLLSSSSDPRDHEFIRGII
RDNVVPWSEKLIEMEDKKIPNSAIADMEKEWYHENELFTFEEALEKQFTASEFESYKEKK
EDLMVNKLGRAYLSLREMKLLAQEVTPLKKIIFDWDAPRTKEGYYMFNGCIEAAIRRSLV
FAPYSDMIWLETKTPDLEQARSFSRKIHKQLPATKLVYNLSPSFNWSAHGFDDKALKSFV
WDLAKEGFTLQLVSLAGLHSDGVSFWELANSFQSDGMKAYVEKVQKREKETNCDIMTHQL
WSGAEYVDSLMKVVQNGASSQTLSTSGESFTETQF
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgattacaatgattaacaacaaaactttcaatagaaaaactacgggaacactgaagaag
ctggttttgtcatcagacaagtcactgcgaagatctttcaacggggcaagcagtactaaa
gacttcgtgttctcggaatcaagtaaagtagaagaatggtgggaatcagccagatttaag
aatatcagtcgtccatactcagctacggatgttgtaaagcatcggggcagccttcctgct
aatacttcaatttatccttcatcttatcaagctcgaaagctgttcaacttactagaagag
aatttcaagaatggtactccacttcacacgttgggagttatcgatcctgtacaaatgagt
cagttggcccgttgcagaaatatcaaagttgcttacatatctggttgggcttgttcttcc
acattagttggatctacaaatgaagtatcgccggattttggcgattatccatacgatact
gtgccgaatcaagtggagagaatattcaaggcgcagcaattgcacgatcgaaaggctttc
ttggaggcctccatcaaaggttctactcctgttgattatttaaaaccaattatcgcggac
gcagacatgggtcacggtggcccaacgactgtaatgaaagttgctaagttgtttgcggag
aaaggggctgctggtattcatcttgaagatcagatggtgggaggcaaaaggtgtggccat
ctaagtggggctgttttggtgcccacagcaacacatcttatgagattgatttccaccagg
tttcaatgggatatcatggggacagaaaatttggttattgcaagaacagattcctgtaat
ggtaagctgttgagttcaagcagtgatccgagagaccacgaattcattaggggtataata
agagataacgtggtgccttggagcgaaaaattgattgagatggaggacaaaaaaattccc
aactccgccattgctgacatggaaaaagaatggtaccatgaaaatgagctgtttacattt
gaagaggccttagaaaagcagtttacggcaagcgagtttgaaagctataaagaaaagaag
gaagaccttatggtaaacaagctgggtagagcatacctaagcttaagagaaatgaaactt
ttagctcaagaagtgacaccactaaagaaaattatatttgactgggatgctccgaggacc
aaagagggatattacatgtttaacggttgtattgaagcagctattagaagatctttggtg
tttgccccatattctgatatgatttggctggaaacgaaaactcctgacctggagcaggca
cgctcattttcaagaaaaattcataaacaacttccagctaccaagctagtatataactta
tctcctagtttcaattggagcgctcacggctttgatgataaggcattaaaatccttcgta
tgggacttggcaaaagaaggcttcacgttgcaactggtttcccttgccggtctgcattca
gatggagtatcattctgggaattagccaatagcttccaaagtgacggaatgaaagcatac
gtcgaaaaagtgcaaaaacgggaaaaggagactaattgtgatatcatgacacaccagcta
tggtctggtgcagaatatgttgattccttaatgaaagttgtccaaaacggtgcttcatcc
caaactttaagtacatctggtgagagctttaccgaaacgcaattttga

DBGET integrated database retrieval system