KEGG   Saccharomyces cerevisiae (budding yeast): YPR019WHelp
Entry
YPR019W           CDS       T00005                                 

Gene name
MCM4, CDC54, HCD21
Definition
MCM DNA helicase complex subunit MCM4 (EC:3.6.4.12)
Orthology
K02212  
DNA replication licensing factor MCM4 [EC:3.6.4.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
DNA replication
Cell cycle - yeast
Meiosis - yeast
Module
MCM complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    YPR019W (MCM4)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YPR019W (MCM4)
   04113 Meiosis - yeast
    YPR019W (MCM4)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     YPR019W (MCM4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XVI:596750..599551
Genome map
AA seq 933 aa AA seqDB search
MSQQSSSPTKEDNNSSSPVVPNPDSVPPQLSSPALFYSSSSSQGDIYGRNNSQNLSQGEG
NIRAAIGSSPLNFPSSSQRQNSDVFQSQGRQGRIRSSASASGRSRYHSDLRSDRALPTSS
SSLGRNGQNRVHMRRNDIHTSDLSSPRRIVDFDTRSGVNTLDTSSSSAPPSEASEPLRII
WGTNVSIQECTTNFRNFLMSFKYKFRKILDEREEFINNTTDEELYYIKQLNEMRELGTSN
LNLDARNLLAYKQTEDLYHQLLNYPQEVISIMDQTIKDCMVSLIVDNNLDYDLDEIETKF
YKVRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEI
DRGVIQEPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVY
DELVDSCRAGDRIEVTGTFRSIPIRANSRQRVLKSLYKTYVDVVHVKKVSDKRLDVDTST
IEQELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGI
LLQLFGGTNKTFTKGGRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVG
LTAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAG
IITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDREL
AKHLTNLYLEDKPEHISQDDVLPVEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKM
GDDSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAIKDYATDP
KTGKIDMNLVQTGKSVIQRKLQEDLSREIMNVLKDQASDSMSFNELIKQINEHSQDRVES
SDIQEALSRLQQEDKVIVLGEGVRRSVRLNNRV
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaacagtctagctctccaacaaaagaggataataactccagctcccccgttgtg
cctaatcctgattctgttccaccacagctttcttccccagctctattttatagctcctct
tcatcacaaggtgatatctatggtcgcaacaatagccagaacttaagtcagggagaggga
aacatcagagctgctataggttcttctccactaaattttccatcttcttcccaaagacaa
aattccgatgttttccaatctcaaggcagacagggcagaattcgttcttctgcgagcgct
tctggaaggtctagatatcattctgatctgagaagtgatagagcactgcctacttcttcc
tcttctttaggccgtaatggtcaaaaccgtgtacacatgcgaagaaatgatattcataca
tctgatttatcctctccaagaagaattgtggattttgatactagatccggcgtgaatact
ttggatacttcttcttcttctgctcctccatcggaagccagtgaacccttgagaataatt
tggggtaccaacgtcagtatccaggaatgtacaactaattttcgtaattttttgatgtct
ttcaagtataaattccgtaaaatattggatgaaagggaggaattcattaacaatactacc
gacgaagaactatactatatcaagcagcttaatgaaatgagagaacttggtacctctaat
ttaaacttggatgctagaaacttacttgcttacaagcaaacagaagacttataccatcaa
ctattaaattatcctcaagaagtgatttctatcatggatcaaactatcaaggactgtatg
gtttccttaatagtagacaacaatttggattacgatttagatgaaatagagaccaagttt
tataaagtaaggccttacaatgtaggttcttgtaaaggtatgcgcgaattgaatccaaat
gatattgataaattgataaacttaaagggtcttgtcctgagatcaactccggttatccct
gatatgaaggtagcgtttttcaaatgcaacgtctgcgatcatacaatggcagtggaaatt
gatagaggagttatacaagagcccgctaggtgtgaacgtattgattgtaatgaacccaat
tccatgtcactgattcacaacaggtgttcattcgcagataaacaagtcattaagttacag
gaaactccagactttgtgcctgatggacaaacgcctcactctatctcattatgtgtttac
gatgaattagtggattcttgcagggcgggcgatcgtattgaggtgactggcacgttcagg
tccatccccattagagctaattccaggcaacgcgtactaaagtcgttgtataaaacatac
gtcgatgtggtccacgttaaaaaagtttcagataagaggttagacgtcgatacttctact
attgaacaagaattaatgcagaacaaggtagatcataacgaggtcgaagaagtaagacaa
attactgatcaggatttagcaaaaattcgcgaggttgcggcaagagaagatttatacagt
ttattagcccgctctattgccccaagtatttacgagctagaagatgtcaagaagggtata
ttacttcagctatttggcggcacgaataaaacctttaccaagggtggccgttatagaggt
gacataaatattttactttgtggggatccttctacttccaaatcgcaaattttgcaatac
gttcacaaaattactcctcgtggtgtgtatacttcgggtaaaggttcatctgccgttggt
ttaactgcttatattacaagggatgtcgacacaaaacaacttgttttggaaagtggtgca
ttagtattgtctgatggaggtgtttgttgtattgacgagtttgataaaatgagtgattct
acaaggtccgtcttgcacgaagtcatggaacagcagactatttcaatcgcaaaagcggga
attatcacaacacttaatgccagaagttctattttggccagtgctaacccaattggttca
cgctacaaccccaatttgcctgtgactgaaaatattgatctaccgcccccactactttcg
agattcgatctggtctatcttgtccttgataaggttgatgagaaaaatgacagagaacta
gccaaacacttaacaaatctttacctggaagataagcccgaacatatttctcaagacgac
gtgctaccagttgaatttttaacgatgtatattagttatgcaaaggagcacatacaccca
ataatcaccgaggccgctaagactgagcttgttcgtgcttatgtaggaatgagaaagatg
ggtgacgattcgagatccgatgagaagagaatcacagctaccacaagacaacttgaaagt
atgattcgtttggctgaggcgcacgccaaaatgaaattgaaaaacgtcgtagagctggag
gatgttcaagaagccgttagattaattagatcagccataaaagattatgcaacagaccct
aaaaccggtaaaatcgacatgaatttagttcaaacaggtaaatcagttattcagagaaaa
ctacaggaggatttgtcaagggaaattatgaatgttttgaaggatcaggcatcagactca
atgtcattcaatgagcttataaaacaaatcaatgaacactctcaagatagagttgagtct
tctgatatccaggaagccttgtcaagattgcaacaagaggacaaggtcattgtccttggc
gagggtgtaaggagatcagttcgcctgaataaccgtgtctga

DBGET integrated database retrieval system