KEGG   Saccharomyces cerevisiae (budding yeast): YPR019WHelp
Entry
YPR019W           CDS       T00005                                 

Gene name
MCM4, CDC54, HCD21
Definition
(RefSeq) MCM DNA helicase complex subunit MCM4 (EC:3.6.4.12)
  KO
K02212  
DNA replication licensing factor MCM4 [EC:3.6.4.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
DNA replication
Cell cycle - yeast
Meiosis - yeast
Module
MCM complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    YPR019W (MCM4)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YPR019W (MCM4)
   04113 Meiosis - yeast
    YPR019W (MCM4)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     YPR019W (MCM4)
DNA replication proteins [BR:sce03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    YPR019W (MCM4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XVI:596750..599551
Genome map
AA seq 933 aa AA seqDB search
MSQQSSSPTKEDNNSSSPVVPNPDSVPPQLSSPALFYSSSSSQGDIYGRNNSQNLSQGEG
NIRAAIGSSPLNFPSSSQRQNSDVFQSQGRQGRIRSSASASGRSRYHSDLRSDRALPTSS
SSLGRNGQNRVHMRRNDIHTSDLSSPRRIVDFDTRSGVNTLDTSSSSAPPSEASEPLRII
WGTNVSIQECTTNFRNFLMSFKYKFRKILDEREEFINNTTDEELYYIKQLNEMRELGTSN
LNLDARNLLAYKQTEDLYHQLLNYPQEVISIMDQTIKDCMVSLIVDNNLDYDLDEIETKF
YKVRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEI
DRGVIQEPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVY
DELVDSCRAGDRIEVTGTFRSIPIRANSRQRVLKSLYKTYVDVVHVKKVSDKRLDVDTST
IEQELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGI
LLQLFGGTNKTFTKGGRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVG
LTAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAG
IITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDREL
AKHLTNLYLEDKPEHISQDDVLPVEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKM
GDDSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAIKDYATDP
KTGKIDMNLVQTGKSVIQRKLQEDLSREIMNVLKDQASDSMSFNELIKQINEHSQDRVES
SDIQEALSRLQQEDKVIVLGEGVRRSVRLNNRV
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaacagtctagctctccaacaaaagaggataataactccagctcccccgttgtg
cctaatcctgattctgttccaccacagctttcttccccagctctattttatagctcctct
tcatcacaaggtgatatctatggtcgcaacaatagccagaacttaagtcagggagaggga
aacatcagagctgctataggttcttctccactaaattttccatcttcttcccaaagacaa
aattccgatgttttccaatctcaaggcagacagggcagaattcgttcttctgcgagcgct
tctggaaggtctagatatcattctgatctgagaagtgatagagcactgcctacttcttcc
tcttctttaggccgtaatggtcaaaaccgtgtacacatgcgaagaaatgatattcataca
tctgatttatcctctccaagaagaattgtggattttgatactagatccggcgtgaatact
ttggatacttcttcttcttctgctcctccatcggaagccagtgaacccttgagaataatt
tggggtaccaacgtcagtatccaggaatgtacaactaattttcgtaattttttgatgtct
ttcaagtataaattccgtaaaatattggatgaaagggaggaattcattaacaatactacc
gacgaagaactatactatatcaagcagcttaatgaaatgagagaacttggtacctctaat
ttaaacttggatgctagaaacttacttgcttacaagcaaacagaagacttataccatcaa
ctattaaattatcctcaagaagtgatttctatcatggatcaaactatcaaggactgtatg
gtttccttaatagtagacaacaatttggattacgatttagatgaaatagagaccaagttt
tataaagtaaggccttacaatgtaggttcttgtaaaggtatgcgcgaattgaatccaaat
gatattgataaattgataaacttaaagggtcttgtcctgagatcaactccggttatccct
gatatgaaggtagcgtttttcaaatgcaacgtctgcgatcatacaatggcagtggaaatt
gatagaggagttatacaagagcccgctaggtgtgaacgtattgattgtaatgaacccaat
tccatgtcactgattcacaacaggtgttcattcgcagataaacaagtcattaagttacag
gaaactccagactttgtgcctgatggacaaacgcctcactctatctcattatgtgtttac
gatgaattagtggattcttgcagggcgggcgatcgtattgaggtgactggcacgttcagg
tccatccccattagagctaattccaggcaacgcgtactaaagtcgttgtataaaacatac
gtcgatgtggtccacgttaaaaaagtttcagataagaggttagacgtcgatacttctact
attgaacaagaattaatgcagaacaaggtagatcataacgaggtcgaagaagtaagacaa
attactgatcaggatttagcaaaaattcgcgaggttgcggcaagagaagatttatacagt
ttattagcccgctctattgccccaagtatttacgagctagaagatgtcaagaagggtata
ttacttcagctatttggcggcacgaataaaacctttaccaagggtggccgttatagaggt
gacataaatattttactttgtggggatccttctacttccaaatcgcaaattttgcaatac
gttcacaaaattactcctcgtggtgtgtatacttcgggtaaaggttcatctgccgttggt
ttaactgcttatattacaagggatgtcgacacaaaacaacttgttttggaaagtggtgca
ttagtattgtctgatggaggtgtttgttgtattgacgagtttgataaaatgagtgattct
acaaggtccgtcttgcacgaagtcatggaacagcagactatttcaatcgcaaaagcggga
attatcacaacacttaatgccagaagttctattttggccagtgctaacccaattggttca
cgctacaaccccaatttgcctgtgactgaaaatattgatctaccgcccccactactttcg
agattcgatctggtctatcttgtccttgataaggttgatgagaaaaatgacagagaacta
gccaaacacttaacaaatctttacctggaagataagcccgaacatatttctcaagacgac
gtgctaccagttgaatttttaacgatgtatattagttatgcaaaggagcacatacaccca
ataatcaccgaggccgctaagactgagcttgttcgtgcttatgtaggaatgagaaagatg
ggtgacgattcgagatccgatgagaagagaatcacagctaccacaagacaacttgaaagt
atgattcgtttggctgaggcgcacgccaaaatgaaattgaaaaacgtcgtagagctggag
gatgttcaagaagccgttagattaattagatcagccataaaagattatgcaacagaccct
aaaaccggtaaaatcgacatgaatttagttcaaacaggtaaatcagttattcagagaaaa
ctacaggaggatttgtcaagggaaattatgaatgttttgaaggatcaggcatcagactca
atgtcattcaatgagcttataaaacaaatcaatgaacactctcaagatagagttgagtct
tctgatatccaggaagccttgtcaagattgcaacaagaggacaaggtcattgtccttggc
gagggtgtaaggagatcagttcgcctgaataaccgtgtctga

DBGET integrated database retrieval system