KEGG   Saccharomyces cerevisiae (budding yeast): YPR025CHelp
Entry
YPR025C           CDS       T00005                                 

Gene name
CCL1
Definition
TFIIH complex kinase subunit CCL1
Orthology
K06634  
cyclin H
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    YPR025C (CCL1)
  Replication and repair
   03420 Nucleotide excision repair
    YPR025C (CCL1)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     YPR025C (CCL1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XVI:complement(613377..614558)
Genome map
AA seq 393 aa AA seqDB search
MTDIQLNGKSTLDTPSATMSAKEKEAKLKSADENNKPPNYKRISDDDLYRHSSQYRMWSY
TKDQLQEKRVDTNARAIAYIEENLLKFREAHNLTEEEIKVLEAKAIPLTMEEELDLVNFY
AKKVQVIAQHLNLPTEVVATAISFFRRFFLENSVMQIDPKSIVHTTIFLACKSENYFISV
DSFAQKAKSTRDSVLKFEFKLLESLKFSLLNHHPYKPLHGFFLDIQNVLYGKVDLNYMGQ
IYDRCKKRITAALLTDVVYFYTPPQITLATLLIEDEALVTRYLETKFPSREGSQESVPGN
EKEEPQNDASTTEKNKEKSTESEEYSIDSAKLLTIIRECKSIIEDCKPPSTEEAKKIAAK
NYYCQNPSTLIQKLKRKLNGEDTSSTVEKKQKT
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacggatattcaactaaatggaaagagtacattagatactccttctgctaccatgtca
gcaaaagaaaaagaggcaaaattaaaatcggctgatgagaataacaagccaccgaactac
aaaagaatttctgacgatgatttatataggcactcttctcagtatagaatgtggtcatac
actaaagatcaacttcaggagaaaagggtagataccaatgcccgagcgattgcttacatt
gaggaaaatttattaaaatttagagaagcacacaatttaacagaagaagaaataaaagta
ctagaagcaaaggctatccctttgacaatggaagaagaactcgatttggtgaatttctac
gcaaaaaaagttcaggtaatagcacagcatctaaatttgccaaccgaagtagtggccact
gcgatatccttttttaggcgttttttcttagaaaattctgttatgcaaatagatcctaaa
agtattgtacatactactatctttctagcctgcaaatcggagaactattttattagcgtg
gactcgtttgctcaaaaggccaaatctactagagatagtgttctcaaattcgagtttaag
ttgttagaatcattgaaattttcactgttgaaccatcatccttacaaaccgcttcatggg
tttttcttagatatccagaacgtcctttatggtaaggttgatttaaattacatgggccaa
atatacgataggtgtaagaagagaataactgccgcattattaaccgatgtcgtatatttc
tacactccaccccaaataacactagcaacattattgattgaggatgaagccttggtcaca
aggtatttagaaacaaaatttcccagcagagaaggtagccaggaatcagtaccgggaaac
gaaaaagaagaaccacaaaatgatgccagtacaactgagaaaaacaaagagaagtccaca
gagagcgaagaatattcgatagactccgcgaagttactaaccataatacgcgagtgtaaa
agtattattgaagattgtaaacctccgagtactgaagaggccaagaaaattgcggcaaaa
aactattattgtcaaaatccatcaacactgattcagaaattaaaaaggaagttgaatgga
gaagatacttcgtccaccgttgagaaaaagcaaaaaacatga

DBGET integrated database retrieval system