KEGG   Saccharomyces cerevisiae (budding yeast): YPR025CHelp
Entry
YPR025C           CDS       T00005                                 

Gene name
CCL1
Definition
Ccl1p
Orthology
K06634  
cyclin H
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:sce03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:sce03420]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XVI:complement(613377..614558)
Genome map
AA seq 393 aa AA seqDB search
MTDIQLNGKSTLDTPSATMSAKEKEAKLKSADENNKPPNYKRISDDDLYRHSSQYRMWSY
TKDQLQEKRVDTNARAIAYIEENLLKFREAHNLTEEEIKVLEAKAIPLTMEEELDLVNFY
AKKVQVIAQHLNLPTEVVATAISFFRRFFLENSVMQIDPKSIVHTTIFLACKSENYFISV
DSFAQKAKSTRDSVLKFEFKLLESLKFSLLNHHPYKPLHGFFLDIQNVLYGKVDLNYMGQ
IYDRCKKRITAALLTDVVYFYTPPQITLATLLIEDEALVTRYLETKFPSREGSQESVPGN
EKEEPQNDASTTEKNKEKSTESEEYSIDSAKLLTIIRECKSIIEDCKPPSTEEAKKIAAK
NYYCQNPSTLIQKLKRKLNGEDTSSTVEKKQKT
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacggatattcaactaaatggaaagagtacattagatactccttctgctaccatgtca
gcaaaagaaaaagaggcaaaattaaaatcggctgatgagaataacaagccaccgaactac
aaaagaatttctgacgatgatttatataggcactcttctcagtatagaatgtggtcatac
actaaagatcaacttcaggagaaaagggtagataccaatgcccgagcgattgcttacatt
gaggaaaatttattaaaatttagagaagcacacaatttaacagaagaagaaataaaagta
ctagaagcaaaggctatccctttgacaatggaagaagaactcgatttggtgaatttctac
gcaaaaaaagttcaggtaatagcacagcatctaaatttgccaaccgaagtagtggccact
gcgatatccttttttaggcgttttttcttagaaaattctgttatgcaaatagatcctaaa
agtattgtacatactactatctttctagcctgcaaatcggagaactattttattagcgtg
gactcgtttgctcaaaaggccaaatctactagagatagtgttctcaaattcgagtttaag
ttgttagaatcattgaaattttcactgttgaaccatcatccttacaaaccgcttcatggg
tttttcttagatatccagaacgtcctttatggtaaggttgatttaaattacatgggccaa
atatacgataggtgtaagaagagaataactgccgcattattaaccgatgtcgtatatttc
tacactccaccccaaataacactagcaacattattgattgaggatgaagccttggtcaca
aggtatttagaaacaaaatttcccagcagagaaggtagccaggaatcagtaccgggaaac
gaaaaagaagaaccacaaaatgatgccagtacaactgagaaaaacaaagagaagtccaca
gagagcgaagaatattcgatagactccgcgaagttactaaccataatacgcgagtgtaaa
agtattattgaagattgtaaacctccgagtactgaagaggccaagaaaattgcggcaaaa
aactattattgtcaaaatccatcaacactgattcagaaattaaaaaggaagttgaatgga
gaagatacttcgtccaccgttgagaaaaagcaaaaaacatga

DBGET integrated database retrieval system