KEGG   Saccharomyces cerevisiae (budding yeast): YPR054WHelp
Entry
YPR054W           CDS       T00005                                 

Gene name
SMK1
Definition
Smk1p (EC:2.7.11.24)
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XVI:666280..667446
Genome map
AA seq 388 aa AA seqDB search
MNCTLTDNTRAINVASNLGAPQQRTIFAKERISIPGYYEIIQFLGKGAYGTVCSVKFKGR
SPAARIAVKKISNIFNKEILLKRAIRELKFMNFFKGHKNIVNLIDLEIVTSSPYDGLYCY
QELIDYDLAKVIHSSVQLSEFHIKYFLYQILCGLKYIHSADVIHRDLKPGNILCTLNGCL
KICDFGLARGIHAGFFKCHSTVQPHITNYVATRWYRAPELLLSNQPYSKSVDIWAVGCIL
AEFYARKPVFMGRDSMHQIFEIIKVLGTPDKDILIKFGTIKAWNLGKNSNNPVYKKIPWS
NIFPFASHEAINLIESLLHWDSTHRLNVEQAISHPFLNEVRKPDDEPVCLQGPFDFTYES
ELNSMSKLRDYLVEEVKNFKTDLSSSSL
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaattgcacacttacagataataccagagccataaatgtggcctccaacctcggtgct
cctcaacagaggacgatttttgccaaggagagaatatccatcccaggatactacgagata
atccaattcctgggcaagggagcctatgggacagtgtgctcagtgaagtttaagggtcga
agcccagctgctaggatagcggtaaagaagatcagcaacatctttaataaggagatcctt
ttgaaaagggccatccgtgagctaaaattcatgaacttcttcaagggccataaaaatatt
gtaaatctaatcgatctagagatagtgaccagctcgccctatgacggactgtattgctac
caggaactgattgattatgatttggcaaaagtcatacattcgtccgtgcagctctcggag
tttcatatcaaatactttctttaccaaatcctgtgtgggctaaagtacatacacagtgca
gatgtcatccaccgagatttgaagcctgggaacatattgtgcacattgaatggctgtttg
aagatctgcgattttggtctcgctaggggtattcatgccggatttttcaagtgtcattcc
actgtgcagccccatataaccaactacgttgctacaagatggtatagggcgcctgagctg
cttctttccaaccaaccgtatagtaagtccgtagacatatgggctgtagggtgcattctt
gcagaattctatgctcgaaagcctgttttcatggggcgtgactccatgcaccagatattt
gaaatcatcaaagtcttgggtactcctgataaagatattctgatcaagtttggcaccatt
aaagcttggaatctaggcaaaaacagtaataaccctgtatataaaaaaatcccatggtcc
aacattttcccctttgcctcgcatgaagcaatcaatctcatagagtcattacttcattgg
gactcaacacataggttaaacgtggaacaagctatatcacatccgttcctaaacgaggtg
cggaagccagacgacgagcctgtttgccttcagggtcctttcgacttcacctatgaatcc
gagttgaattcaatgtccaaattaagagactacttggttgaagaagtgaaaaatttcaaa
accgatttgtcctcctcgtctttatag

DBGET integrated database retrieval system