KEGG   Saccharomyces cerevisiae (budding yeast): YPR068CHelp
Entry
YPR068C           CDS       T00005                                 

Gene name
HOS1, CST3
Definition
Hos1p (EC:3.5.1.98)
Orthology
K11482  
histone deacetylase HOS1 [EC:3.5.1.98]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     YPR068C (HOS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XVI:complement(682941..684353)
Genome map
AA seq 470 aa AA seqDB search
MSKLVISTSIFQSQVADLLPCNNHQKSQLTYSLINAYDLLQHFDEVLTFPYARKDDLLEF
HSKSYIDYLINGRFNKMMAQDVNNPMVESKWSELSELADNWNEKIDYNPSQDLQRFTTRE
NLYNYYLNHSQALENNMDCINNSEVPTNDKPTDTYILNSETKQYNLEGDCPIFSYLPMYC
QVITGATLNLLDHLSPTERLIGINWDGGRHHAFKQRASGFCYINDVVLLIQRLRKAKLNK
ITYVDFDLHHGDGVEKAFQYSKQIQTISVHLYEPGFFPGTGSLSDSRKDKNVVNIPLKHG
CDDNYLELIASKIVNPLIERHEPEALIIECGGDGLLGDRFNEWQLTIRGLSRIIINIMKS
YPRAHIFLLGGGGYNDLLMSRFYTYLTWCVTKQFSNLRCGDNNSFQIDPFDVCDGDDSEQ
FIREHDLVEMYNEENYQYWIYEMEGSSRMKMLRNDNKDRDMVELMKFYEL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaattggtcatatcaacgtcaatatttcagtctcaagtagcagatttactccca
tgtaacaatcatcaaaaatcgcagctgacatattccctaataaacgcgtacgatcttctc
cagcactttgacgaagtgctaacatttccctacgccagaaaggatgatctgctggagttc
cattcgaaatcatatatcgattatttgataaatggcagattcaataaaatgatggcacaa
gatgtaaataatcccatggtagagtccaaatggagtgagttgagtgaattggccgataat
tggaacgaaaaaatcgactacaatccatcgcaagatcttcagagattcaccactagagag
aatctctataattattatctgaatcactcacaagcgctcgaaaataatatggactgtatt
aataacagtgaggtgcccaccaatgataaaccaacagatacttatattttaaattctgaa
acaaaacagtataatttagagggagattgcccgattttttcataccttcctatgtactgt
caagttattacaggtgcgactttaaacttgttggatcatctatcgcctacagaacgtctt
atcggtataaattgggatggtggaagacatcatgcctttaaacagagggcaagcggattc
tgctatataaatgacgtggtactgttaatacagagattgcgcaaagcaaagctaaataaa
atcacgtacgttgacttcgacttgcatcatggtgacggtgtagaaaaggctttccaatat
tctaaacaaatacagacaatttcagtacatctctacgagcctggtttttttcctggaact
ggttctttaagtgattcaagaaaggataagaacgtggttaatattcctttaaagcatggt
tgtgatgacaactacttggaattgatcgcatccaaaatcgtcaatcctctaatagaaaga
cacgaacctgaggccttaataattgaatgtggtggtgatgggcttctgggtgatagattc
aatgaatggcagctaacaatacgagggctttctcgaatcatcataaatatcatgaaaagt
tatcctcgagcgcacatattcctacttggagggggtgggtacaacgatttactaatgagt
agattttatacgtacttgacttggtgtgttacaaagcagttttccaacttaagatgtggt
gacaataattcgttccaaatcgatccatttgatgtctgtgatggtgatgattctgaacaa
tttatacgtgaacatgatcttgttgaaatgtataatgaagagaactatcagtattggata
tatgagatggaaggaagttctcgaatgaaaatgttaaggaatgacaataaggatagagat
atggtcgaacttatgaagttttacgaactgtaa

DBGET integrated database retrieval system