KEGG   Saccharomyces cerevisiae (budding yeast): YPR074CHelp
Entry
YPR074C           CDS       T00005                                 

Gene name
TKL1
Definition
transketolase TKL1 (EC:2.2.1.1)
Orthology
K00615  
transketolase [EC:2.2.1.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:sce01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sce01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sce00030]
Metabolism; Metabolism of terpenoids and polyketides; Biosynthesis of ansamycins
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
XVI:complement(692796..694838)
Genome map
AA seq 680 aa AA seqDB search
MTQFTDIDKLAVSTIRILAVDTVSKANSGHPGAPLGMAPAAHVLWSQMRMNPTNPDWINR
DRFVLSNGHAVALLYSMLHLTGYDLSIEDLKQFRQLGSRTPGHPEFELPGVEVTTGPLGQ
GISNAVGMAMAQANLAATYNKPGFTLSDNYTYVFLGDGCLQEGISSEASSLAGHLKLGNL
IAIYDDNKITIDGATSISFDEDVAKRYEAYGWEVLYVENGNEDLAGIAKAIAQAKLSKDK
PTLIKMTTTIGYGSLHAGSHSVHGAPLKADDVKQLKSKFGFNPDKSFVVPQEVYDHYQKT
ILKPGVEANNKWNKLFSEYQKKFPELGAELARRLSGQLPANWESKLPTYTAKDSAVATRK
LSETVLEDVYNQLPELIGGSADLTPSNLTRWKEALDFQPPSSGSGNYSGRYIRYGIREHA
MGAIMNGISAFGANYKPYGGTFLNFVSYAAGAVRLSALSGHPVIWVATHDSIGVGEDGPT
HQPIETLAHFRSLPNIQVWRPADGNEVSAAYKNSLESKHTPSIIALSRQNLPQLEGSSIE
SASKGGYVLQDVANPDIILVATGSEVSLSVEAAKTLAAKNIKARVVSLPDFFTFDKQPLE
YRLSVLPDNVPIMSVEVLATTCWGKYAHQSFGIDRFGASGKAPEVFKFFGFTPEGVAERA
QKTIAFYKGDKLISPLKKAF
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgactcaattcactgacattgataagctagccgtctccaccataagaattttggctgtg
gacaccgtatccaaggccaactcaggtcacccaggtgctccattgggtatggcaccagct
gcacacgttctatggagtcaaatgcgcatgaacccaaccaacccagactggatcaacaga
gatagatttgtcttgtctaacggtcacgcggtcgctttgttgtattctatgctacatttg
actggttacgatctgtctattgaagacttgaaacagttcagacagttgggttccagaaca
ccaggtcatcctgaatttgagttgccaggtgttgaagttactaccggtccattaggtcaa
ggtatctccaacgctgttggtatggccatggctcaagctaacctggctgccacttacaac
aagccgggctttaccttgtctgacaactacacctatgttttcttgggtgacggttgtttg
caagaaggtatttcttcagaagcttcctccttggctggtcatttgaaattgggtaacttg
attgccatctacgatgacaacaagatcactatcgatggtgctaccagtatctcattcgat
gaagatgttgctaagagatacgaagcctacggttgggaagttttgtacgtagaaaatggt
aacgaagatctagccggtattgccaaggctattgctcaagctaagttatccaaggacaaa
ccaactttgatcaaaatgaccacaaccattggttacggttccttgcatgccggctctcac
tctgtgcacggtgccccattgaaagcagatgatgttaaacaactaaagagcaaattcggt
ttcaacccagacaagtcctttgttgttccacaagaagtttacgaccactaccaaaagaca
attttaaagccaggtgtcgaagccaacaacaagtggaacaagttgttcagcgaataccaa
aagaaattcccagaattaggtgctgaattggctagaagattgagcggccaactacccgca
aattgggaatctaagttgccaacttacaccgccaaggactctgccgtggccactagaaaa
ttatcagaaactgttcttgaggatgtttacaatcaattgccagagttgattggtggttct
gccgatttaacaccttctaacttgaccagatggaaggaagcccttgacttccaacctcct
tcttccggttcaggtaactactctggtagatacattaggtacggtattagagaacacgct
atgggtgccataatgaacggtatttcagctttcggtgccaactacaaaccatacggtggt
actttcttgaacttcgtttcttatgctgctggtgccgttagattgtccgctttgtctggc
cacccagttatttgggttgctacacatgactctatcggtgtcggtgaagatggtccaaca
catcaacctattgaaactttagcacacttcagatccctaccaaacattcaagtttggaga
ccagctgatggtaacgaagtttctgccgcctacaagaactctttagaatccaagcatact
ccaagtatcattgctttgtccagacaaaacttgccacaattggaaggtagctctattgaa
agcgcttctaagggtggttacgtactacaagatgttgctaacccagatattattttagtg
gctactggttccgaagtgtctttgagtgttgaagctgctaagactttggccgcaaagaac
atcaaggctcgtgttgtttctctaccagatttcttcacttttgacaaacaacccctagaa
tacagactatcagtcttaccagacaacgttccaatcatgtctgttgaagttttggctacc
acatgttggggcaaatacgctcatcaatccttcggtattgacagatttggtgcctccggt
aaggcaccagaagtcttcaagttcttcggtttcaccccagaaggtgttgctgaaagagct
caaaagaccattgcattctataagggtgacaagctaatttctcctttgaaaaaagctttc
taa

DBGET integrated database retrieval system