KEGG   Saccharomyces cerevisiae (budding yeast): YPR111WHelp
Entry
YPR111W           CDS       T00005                                 

Gene name
DBF20
Definition
serine/threonine-protein kinase DBF20 (EC:2.7.11.1)
Orthology
K06686  
cell cycle protein kinase DBF20 [EC:2.7.11.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YPR111W (DBF20)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.-  
     YPR111W (DBF20)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XVI:747306..749000
Genome map
AA seq 564 aa AA seqDB search
MFSRSDREVDDLAGNMSHLGFYDLNIPKPTSPQAQYRPARKSENGRLTPGLPRSYKPCDS
DDQDTFKNRISLNHSPKKLPKDFHERASQSKTQRVVNVCQLYFLDYYCDMFDYVISRRQR
TKQVLRYLEQQRSVKNVSNKVLNEEWALYLQREHEVLRKRRLKPKHKDFQILTQVGQGGY
GQVYLAKKKDSDEICALKILNKKLLFKLNETNHVLTERDILTTTRSDWLVKLLYAFQDPE
SLYLAMEFVPGGDFRTLLINTRILKSGHARFYISEMFCAVNALHELGYTHRDLKPENFLI
DATGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTERSIEDRRKIYHNMRKTE
INYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLR
YWKKTLRRPRTEDRRAAFSDRTWDLITRLIADPINRVRSFEQVRKMSYFAEINFETLRTS
SPPFIPQLDDETDAGYFDDFTNEEDMAKYADVFKRQNKLSAMVDDSAVDSKLVGFTFRHR
DGKQGSSGILYNGSEHSDPFSTFY
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgttttcacgaagtgatcgagaggtagatgatttggctggtaatatgagtcatttaggg
ttctatgatttgaatattcctaaacctacttctccacaggcgcaatataggcctgctaga
aagagcgaaaatggaagattaactcccggacttccaagatcatataagccgtgtgattca
gatgatcaagataccttcaaaaatcgcatttcattgaatcactcaccgaagaagctaccc
aaggattttcacgagcgtgcttcccaaagtaaaacccagagagttgttaatgtatgccaa
ctttactttctcgactattactgtgacatgtttgattatgttattagcagaagacaacgt
acgaagcaggtgctaagatatcttgaacagcaaagaagtgtcaaaaacgtttctaataag
gttttaaatgaagaatgggctttgtatttgcaaagagaacacgaagtactgagaaaaagg
aggttgaaacctaagcacaaggattttcagatactgacacaagttggacagggtggttat
gggcaagtttatcttgcaaaaaaaaaagacagtgatgaaatttgtgctttgaaaatatta
aacaagaaacttttattcaaactaaacgagacgaatcacgtccttactgagagggacata
ctaaccacaactagatctgactggcttgtgaagttgctttatgcatttcaggatccagag
agcctatatttagcaatggaatttgtacctggtggtgattttcgcacattgttaataaat
acaaggatattgaagagcggtcacgcaaggttctatatcagcgaaatgttttgtgccgtg
aacgcgttgcatgaacttggttacactcaccgggatttaaagccggagaatttcttgatt
gatgctacagggcatatcaagctgaccgattttggtctagcagcagggaccgtatcaaat
gaaagaatcgaaagcatgaaaatacgcttagaagaagtaaagaatttggaatttcctgct
ttcacagaaaggtctatcgaggatagaaggaaaatatatcataacatgaggaagacagaa
attaattacgctaactctatggtcggttcgcctgattatatggccctagaagttctggaa
ggtaaaaaatacgattttacagtggattattggtcattaggctgtatgctttttgaaagt
ttggttggatatacaccttttagtggttcttctactaatgaaacttacgagaatttaaga
tattggaaaaaaactttaagaaggccccgtactgaggatagaagagcagcattctcagat
agaacctgggatttaattacaagactaatagctgaccccatcaacagagtacgatctttt
gagcaagttcgcaaaatgtcttatttcgcagagatcaattttgaaaccctaagaacaagt
tctccaccatttattcctcaattagatgatgaaacggatgcaggttatttcgatgacttc
acaaatgaagaagatatggctaaatatgcagatgtcttcaaaagacagaacaaattatct
gcaatggtcgatgactctgccgttgattccaagcttgttggatttacttttaggcataga
gatggaaaacaaggttcaagcgggatactttacaatggttcagaacattcagaccctttt
tcaactttttattaa

DBGET integrated database retrieval system