KEGG   Saccharomyces cerevisiae (budding yeast): YPR119WHelp
Entry
YPR119W           CDS       T00005                                 

Gene name
CLB2
Definition
Clb2p
Orthology
K02220  
G2/mitotic-specific cyclin 1/2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XVI:771653..773128
Genome map
AA seq 491 aa AA seqDB search
MSNPIENTENSQNTSSSRFLRNVQRLALNNVTNTTFQKSNANNPALTNFKSTLNSVKKEG
SRIPQFTRESVSRSTAAQEEKRTLKENGIQLPKNNLLDDKENQDPSSQQFGALTSIKEGR
AELPANISLQESSSAKEIIQHDPLKGVGSSTEVVHNSVENEKLHPARSQLQVRNTESETD
SGKKRPISTIVEQELPKKFKVCDENGKEEYEWEDLDAEDVNDPFMVSEYVNDIFEYLHQL
EVITLPKKEDLYQHRNIHQNRDILVNWLVKIHNKFGLLPETLYLAINIMDRFLGKELVQL
DKLQLVGTSCLFIASKYEEVYSPSIKHFASETDGACTEDEIKEGEKFILKTLKFNLNYPN
PMNFLRRISKADDYDIQSRTLAKFLLEISLVDFRFIGILPSLCAAAAMFMSRKMLGKGKW
DGNLIHYSGGYTKEELAPVCHMIMDYLVSPIVHDEFHRKYQSRRFMKASIISVQWALKVR
KNGYDIMTLHE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacccaatagaaaacacagaaaactcacagaatactagttcatcaaggtttttg
aggaatgtacaaaggttggccttaaacaatgtaacaaatacgacatttcaaaagagtaat
gcgaataatccagccctaacaaatttcaaatctacactaaactcagtaaagaaggaggga
agtcggattcctcaatttactagagaaagcgtatcaagatcaacagccgcacaagaggag
aaaagaaccctgaaagaaaatggtatccaactccccaaaaacaatcttttagatgataaa
gaaaaccaagacccaagtagtcagcaatttggtgcgctaacttctataaaggaggggaga
gctgagctgcctgcaaatataagtttacaagaatcctcctcagcgaaggagataatccag
catgatcccctaaaaggcgttggatcaagcactgaggtagtccataactcggtagaaaac
gaaaaacttcatccagctagaagtcaacttcaagttagaaataccgaaagtgaaactgat
agtggaaaaaaaagaccaatttctacaattgttgaacaagaactgcccaaaaagtttaaa
gtgtgcgatgaaaatggcaaagaagaatatgaatgggaagacctagatgcagaagatgta
aatgatccattcatggtcagcgagtacgtcaatgatatattcgaatatctccaccaacta
gaggtcattactcttccaaagaaggaagatctctatcagcatagaaatattcatcaaaat
cgagatatcctagttaattggttggttaaaatccataataaattcggcttattaccggag
actttgtatcttgccattaacataatggacaggtttttaggtaaagagctagttcaactg
gataagttacaattggttggcacatcatgccttttcattgcctctaaatatgaagaggtc
tattctcctagtataaaacatttcgcatcagagacagacggtgcatgtacggaagatgaa
atcaaagaaggggagaaattcattttaaagacattgaaatttaacctaaattatcccaat
ccgatgaattttctgagaagaatttcgaaagcagatgactacgatatacagtctcgaact
cttgccaaattcttattagagatatcattggtagatttcagatttattgggatactaccc
tcattgtgtgcagcagctgcgatgtttatgtcgagaaaaatgttaggtaaaggtaaatgg
gatggaaatctaatacactatagcggcgggtatactaaagaagaacttgcgcccgtgtgt
cacatgataatggattatctagtgagtccaattgttcatgatgaatttcatagaaaatat
caatctagaagatttatgaaagcttctataatttccgtccaatgggctttaaaggttaga
aaaaacggctatgatataatgaccttgcatgaatga

DBGET integrated database retrieval system