KEGG   Saccharomyces cerevisiae (budding yeast): YPR120CHelp
Entry
YPR120C           CDS       T00005                                 

Gene name
CLB5
Definition
Clb5p
Orthology
K06651  
S-phase entry cyclin 5/6
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:sce04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XVI:complement(773875..775182)
Genome map
AA seq 435 aa AA seqDB search
MGENHDHEQSIKRNSMIYNENERQLCNSNLKILQNKRALSKNDSSSKQQVQDSKPRRALT
DVPVNNNPLSQNKRIVAGSKAAKVRREENIRPIVSAVQKRQIYNDRTAAEQEEEEEEEGE
DDDAASIVNKKRRIDAEGVSEIVGWQDLDYVEKDDTAMVAEYSAEIFAFLYRRELETLPS
HNYLLDKTSKYYLRPSMRTILVDWLVEVHEKFQCYPETLFLSINLMDRFLAKNKVTMNKL
QLLAVTSLFIAAKFEEVNLPKLAEYAYITDGAASKNDIKNAEMFMLTSLEFNIGWPNPLN
FLRRISKADDYDPVNRNIGKFILEYAYCCHQFIHLPPSTVSAMAMYIARRMTNRNKNELW
NGTLQHYSGGIDPIHDEAFQSLCIDLVKDIASSKTHLDSLILKYKKPRYGSVYFQTFKWC
TSEMHSNFQNLFNLK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgggagagaaccacgaccatgagcagagtattaaaagaaattctatgatttataatgaa
aatgagaggcagttgtgcaattcaaacctaaagattcttcaaaataaaagggccctttca
aaaaatgacagctctagtaagcagcaggttcaggattctaaaccaagaagggctttaaca
gatgtaccagtgaacaataatcctttaagccagaacaagagaatagtagcagggagcaag
gcggccaaagtacgaagagaagaaaacattagacctattgttagcgccgttcaaaaaaga
cagatatataacgatcgaacggcagcagagcaagaagaagaagaagaagaagaaggagaa
gatgatgatgctgcttcgatagtgaacaaaaaacgcagaatagacgctgaaggagtgagt
gaaatagtaggctggcaggacctagattatgttgaaaaagatgatactgcaatggtagca
gaatattctgctgaaatttttgcatttttatatagaagagaattagaaacgttaccatcg
cacaactatttactcgacaaaacgtccaagtattatttgaggccttccatgagaacaata
ttagtggattggctggtagaggtgcacgaaaaatttcaatgctatccggaaacgttattc
ctatccataaacttaatggatagatttttagctaaaaataaagttacgatgaacaagtta
caattattggcagttacctcacttttcatcgcggcaaaatttgaagaggtaaatttgccc
aaactagctgaatacgcttatatcactgacggcgcggcttctaaaaacgacataaaaaat
gcggaaatgttcatgctcacttccttagaattcaacattggttggcccaacccactcaat
ttcctaaggaggatctccaaggcagatgattacgatccggttaatagaaatattggtaag
tttattttagagtatgcctactgctgccaccaattcattcatttacctccatctaccgta
agcgcaatggcaatgtatatagcgagaagaatgaccaacagaaacaagaacgagctatgg
aatggaacactacagcattacagtggtggtatcgatccaatacacgatgaagcgtttcag
tctctctgcattgatctagtcaaagacatcgctagttccaaaactcatttagattcattg
attttgaagtacaagaaaccaaggtatggctctgtttatttccaaactttcaagtggtgt
acatccgaaatgcatagcaactttcaaaatctatttaatcttaagtag

DBGET integrated database retrieval system