KEGG   Saccharomyces cerevisiae (budding yeast): YPR120CHelp
Entry
YPR120C           CDS       T00005                                 

Gene name
CLB5
Definition
(RefSeq) B-type cyclin CLB5
  KO
K06651  S-phase entry cyclin 5/6
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    YPR120C (CLB5)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YPR120C (CLB5)
   04113 Meiosis - yeast
    YPR120C (CLB5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyclin_N Cyclin_C
Motif
Other DBs
NCBI-GeneID: 856237
NCBI-ProteinID: NP_015445
SGD: S000006324
UniProt: P30283
Position
XVI:complement(773875..775182)
Genome map
AA seq 435 aa AA seqDB search
MGENHDHEQSIKRNSMIYNENERQLCNSNLKILQNKRALSKNDSSSKQQVQDSKPRRALT
DVPVNNNPLSQNKRIVAGSKAAKVRREENIRPIVSAVQKRQIYNDRTAAEQEEEEEEEGE
DDDAASIVNKKRRIDAEGVSEIVGWQDLDYVEKDDTAMVAEYSAEIFAFLYRRELETLPS
HNYLLDKTSKYYLRPSMRTILVDWLVEVHEKFQCYPETLFLSINLMDRFLAKNKVTMNKL
QLLAVTSLFIAAKFEEVNLPKLAEYAYITDGAASKNDIKNAEMFMLTSLEFNIGWPNPLN
FLRRISKADDYDPVNRNIGKFILEYAYCCHQFIHLPPSTVSAMAMYIARRMTNRNKNELW
NGTLQHYSGGIDPIHDEAFQSLCIDLVKDIASSKTHLDSLILKYKKPRYGSVYFQTFKWC
TSEMHSNFQNLFNLK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgggagagaaccacgaccatgagcagagtattaaaagaaattctatgatttataatgaa
aatgagaggcagttgtgcaattcaaacctaaagattcttcaaaataaaagggccctttca
aaaaatgacagctctagtaagcagcaggttcaggattctaaaccaagaagggctttaaca
gatgtaccagtgaacaataatcctttaagccagaacaagagaatagtagcagggagcaag
gcggccaaagtacgaagagaagaaaacattagacctattgttagcgccgttcaaaaaaga
cagatatataacgatcgaacggcagcagagcaagaagaagaagaagaagaagaaggagaa
gatgatgatgctgcttcgatagtgaacaaaaaacgcagaatagacgctgaaggagtgagt
gaaatagtaggctggcaggacctagattatgttgaaaaagatgatactgcaatggtagca
gaatattctgctgaaatttttgcatttttatatagaagagaattagaaacgttaccatcg
cacaactatttactcgacaaaacgtccaagtattatttgaggccttccatgagaacaata
ttagtggattggctggtagaggtgcacgaaaaatttcaatgctatccggaaacgttattc
ctatccataaacttaatggatagatttttagctaaaaataaagttacgatgaacaagtta
caattattggcagttacctcacttttcatcgcggcaaaatttgaagaggtaaatttgccc
aaactagctgaatacgcttatatcactgacggcgcggcttctaaaaacgacataaaaaat
gcggaaatgttcatgctcacttccttagaattcaacattggttggcccaacccactcaat
ttcctaaggaggatctccaaggcagatgattacgatccggttaatagaaatattggtaag
tttattttagagtatgcctactgctgccaccaattcattcatttacctccatctaccgta
agcgcaatggcaatgtatatagcgagaagaatgaccaacagaaacaagaacgagctatgg
aatggaacactacagcattacagtggtggtatcgatccaatacacgatgaagcgtttcag
tctctctgcattgatctagtcaaagacatcgctagttccaaaactcatttagattcattg
attttgaagtacaagaaaccaaggtatggctctgtttatttccaaactttcaagtggtgt
acatccgaaatgcatagcaactttcaaaatctatttaatcttaagtag

DBGET integrated database retrieval system