KEGG   Saccharomyces cerevisiae (budding yeast): YPR145WHelp
Entry
YPR145W           CDS       T00005                                 

Gene name
ASN1
Definition
asparagine synthase (glutamine-hydrolyzing) 1 (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YPR145W (ASN1)
Enzymes [BR:sce01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     YPR145W (ASN1)
Peptidases [BR:sce01002]
 Cysteine Peptidases
  Family C44
   YPR145W (ASN1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XVI:822620..824338
Genome map
AA seq 572 aa AA seqDB search
MCGIFAAFRHEDVHRYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGVESGAQ
PITSSDGEYMLCVNGEIYNHIQLREECADYEFGTLSDCEPIIPMYLKHDIDAPKYLDGMF
AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV
YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS
SLIASIAARETAKATNDVEPSTYDSKARHLAGIDDDGKLHTAGWTSLHSFAIGLPNAPDL
QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR
VPFLDREFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE
QFSDGVGYSWIDGLKDTAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV
ADTVMRWIPKADWGCAEDPSGRYAQIHEKHIE
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtattttcgccgctttcaggcacgaagacgtgcatagatataagccaaaggct
ctacaactatcaaaaagaatcagacaccgtggtccagattggtccggtaatgctatcaag
aactccactatatttgttcatgaaagactagccattgtcggtgtggaatccggtgctcaa
ccaattacttcttcagacggagagtacatgctatgtgttaacggtgaaatctacaaccac
attcaattaagagaagaatgcgcagactacgagtttggaacactgagtgactgtgagcct
atcatcccaatgtacttaaagcacgatatcgacgctcctaagtacttggatggtatgttt
gcttggactctttacgacgctaaacaagatcgtattgtggcagccagagacccaatcggt
attacgacattatatatgggacgctcttccgcttctccaaagaccgtttattttgcatcc
gaactaaaatgtttgactgacgactgtgacactatcactgcattcccaccgggccacgta
tacgattctaagactgacaagatcacccgttacttcacaccagattggctggacgaaaaa
cgcattccttccaccccaatagattacatggcaattagacactccttagaaaaagccgtt
agaaagagattaatggccgaagtcccatacggtgttctattgtcgggtggtttggactcc
tctttaatcgcttccattgctgcccgtgaaactgcaaaggccactaacgatgtcgaacca
tcaacttacgatagtaaggcaagacatctagcaggtatcgacgatgacggtaagctacac
actgctggttggacaagtctccattcctttgccatcggtttaccaaatgctccagatttg
caagccgcaagaaaggttgccaaattcatcggctctattcatcatgaacacacctttaca
ttacaagaaggtttggatgctttggacgacgtgatctaccatttggaaacttacgacgtt
accactatcagagcttccactccaatgttcttactatccagaaagattaaggcccaaggg
gtcaagatggttctttccggtgaaggttccgatgaaatcttcggtggttatctatatttc
gcacaagctccttctgcggcagaatttcacactgaatccgtgcaacgtgtcaagaacttg
catttggcagattgtttgagagctaacaagtctacgatggcttggggtctagaagctcgt
gttccattcttagacagagaatttttgcaattgtgtatgaacatcgatccaaatgaaaag
atgattaaaccaaaggaaggacgtattgaaaagtacattctaaggaaggcattcgacacc
acaggagaaccagatgctaagccatatttaccagaagaaattttatggagacaaaaagaa
caattttccgacggtgttggttactcctggatcgacggattaaaagataccgccgaagca
gtcatttcagatgaaatgtttgccagtccaaaggccgaatggggtagtgacattccaacc
acaaaagaggctttctggtacagactaaaattcgatgctttgttccctcaaaagaccgtg
gctgacaccgttatgagatggattccaaaggccgactggggttgtgctgaagatccttct
ggtagatatgcccaaattcatgaaaaacatatcgaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system