KEGG   Saccharomyces cerevisiae (budding yeast): YPR162CHelp
Entry
YPR162C           CDS       T00005                                 

Gene name
ORC4
Definition
origin recognition complex subunit 4
Orthology
K02606  
origin recognition complex subunit 4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Module
Origin recognition complex
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:sce04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XVI:complement(866715..868304)
Genome map
AA seq 529 aa AA seqDB search
MTISEARLSPQVNLLPIKRHSNEEVEETAAILKKRTIDNEKCKDSDPGFGSLQRRLLQQL
YGTLPTDEKIIFTYLQDCQQEIDRIIKQSIIQKESHSVILVGPRQSYKTYLLDYELSLLQ
QSYKEQFITIRLNGFIHSEQTAINGIATQLEQQLQKIHGSEEKIDDTSLETISSGSLTEV
FEKILLLLDSTTKTRNEDSGEVDRESITKITVVFIFDEIDTFAGPVRQTLLYNLFDMVEH
SRVPVCIFGCTTKLNILEYLEKRVKSRFSQRVIYMPQIQNLDDMVDAVRNLLTVRSEISP
WVSQWNETLEKELSDPRSNLNRHIRMNFETFRSLPTLKNSIIPLVATSKNFGSLCTAIKS
CSFLDIYNKNQLSNNLTGRLQSLSDLELAILISAARVALRAKDGSFNFNLAYAEYEKMIK
AINSRIPTVAPTTNVGTGQSTFSIDNTIKLWLKKDVKNVWENLVQLDFFTEKSAVGLRDN
ATAAFYASNYQFQGTMIPFDLRSYQMQIILQELRRIIPKSNMYYSWTQL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgactataagcgaagctcgtctatcaccgcaagtcaatcttctcccaataaagaggcac
tcaaacgaagaggtagaggagactgcagcgattctaaaaaagcgtactatagataatgaa
aagtgtaaagacagcgaccctggttttggttcccttcaaagaaggttactgcagcaactt
tatggcacacttcctacggacgaaaagataatcttcacatatttacaagattgtcaacaa
gagatcgatagaatcattaaacaatccattattcagaaagagagtcattcagtaattctc
gtggggcccagacaaagttacaaaacatacttattagactatgaactgtctttgttgcaa
caatcttataaagagcagtttataactatcaggttgaatgggtttattcactccgaacaa
acagctattaacggtatagcaactcaattggaacagcagttgcagaaaattcatggcagt
gaagaaaaaattgacgatacttcattagagactattagcagtggttctttgacagaagtg
tttgagaaaattcttttactcttagattcgaccacgaagacaagaaatgaagatagtggt
gaggttgacagagagagtataacaaagataacagttgtttttatattcgatgaaattgat
acatttgctgggcctgtgaggcaaactttattatacaatctttttgacatggtagaacat
tctcgggtacctgtttgcatttttggctgcacaacgaaattaaatatcttggaatattta
gaaaagagggtaaagagtagattttctcaaagagtgatttatatgccgcaaatacagaat
ctagacgatatggttgacgccgtcagaaatttacttacagttcgctctgaaatctccccc
tgggtttcacaatggaatgaaacgttggaaaaagaactatccgaccctcgatcgaatttg
aatagacatattaggatgaatttcgaaacctttaggtcattacctacattgaaaaatagc
ataattccattagtagcgacatccaaaaattttggttcactctgcactgccataaaatcg
tgttcttttcttgacatatacaataagaaccaactatctaataatttaacaggaaggctc
caatctttatccgatttagagttagccattttgatctcagccgctagggttgccttaagg
gcgaaagacggatcttttaattttaatttagcttatgcagagtatgaaaagatgattaaa
gctatcaactccagaattcccaccgtggctcctactacaaatgtgggaacaggtcaaagt
actttttctatcgacaatactatcaaactatggttgaaaaaggacgtcaagaacgtttgg
gaaaatttagtgcaactggatttttttaccgagaaatcagccgttggtttgagagataat
gcgaccgcagcattttacgctagcaattatcaatttcagggcaccatgatcccgtttgac
ttgagaagttaccagatgcagatcattcttcaggaattaagaagaattatccccaaatct
aatatgtactactcctggacacaactgtga

DBGET integrated database retrieval system