KEGG   Saccharomyces cerevisiae (budding yeast): YPR162CHelp
Entry
YPR162C           CDS       T00005                                 

Gene name
ORC4
Definition
(RefSeq) origin recognition complex subunit 4
  KO
K02606  origin recognition complex subunit 4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Module
sce_M00284  Origin recognition complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YPR162C (ORC4)
   04113 Meiosis - yeast
    YPR162C (ORC4)
DNA replication proteins [BR:sce03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    YPR162C (ORC4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ORC4_C AAA_22 AAA_14 AAA
Motif
Other DBs
NCBI-GeneID: 856291
NCBI-ProteinID: NP_015488
SGD: S000006366
UniProt: P54791
Structure
PDB: 

Jmol
Position
XVI:complement(866715..868304)
Genome map
AA seq 529 aa AA seqDB search
MTISEARLSPQVNLLPIKRHSNEEVEETAAILKKRTIDNEKCKDSDPGFGSLQRRLLQQL
YGTLPTDEKIIFTYLQDCQQEIDRIIKQSIIQKESHSVILVGPRQSYKTYLLDYELSLLQ
QSYKEQFITIRLNGFIHSEQTAINGIATQLEQQLQKIHGSEEKIDDTSLETISSGSLTEV
FEKILLLLDSTTKTRNEDSGEVDRESITKITVVFIFDEIDTFAGPVRQTLLYNLFDMVEH
SRVPVCIFGCTTKLNILEYLEKRVKSRFSQRVIYMPQIQNLDDMVDAVRNLLTVRSEISP
WVSQWNETLEKELSDPRSNLNRHIRMNFETFRSLPTLKNSIIPLVATSKNFGSLCTAIKS
CSFLDIYNKNQLSNNLTGRLQSLSDLELAILISAARVALRAKDGSFNFNLAYAEYEKMIK
AINSRIPTVAPTTNVGTGQSTFSIDNTIKLWLKKDVKNVWENLVQLDFFTEKSAVGLRDN
ATAAFYASNYQFQGTMIPFDLRSYQMQIILQELRRIIPKSNMYYSWTQL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgactataagcgaagctcgtctatcaccgcaagtcaatcttctcccaataaagaggcac
tcaaacgaagaggtagaggagactgcagcgattctaaaaaagcgtactatagataatgaa
aagtgtaaagacagcgaccctggttttggttcccttcaaagaaggttactgcagcaactt
tatggcacacttcctacggacgaaaagataatcttcacatatttacaagattgtcaacaa
gagatcgatagaatcattaaacaatccattattcagaaagagagtcattcagtaattctc
gtggggcccagacaaagttacaaaacatacttattagactatgaactgtctttgttgcaa
caatcttataaagagcagtttataactatcaggttgaatgggtttattcactccgaacaa
acagctattaacggtatagcaactcaattggaacagcagttgcagaaaattcatggcagt
gaagaaaaaattgacgatacttcattagagactattagcagtggttctttgacagaagtg
tttgagaaaattcttttactcttagattcgaccacgaagacaagaaatgaagatagtggt
gaggttgacagagagagtataacaaagataacagttgtttttatattcgatgaaattgat
acatttgctgggcctgtgaggcaaactttattatacaatctttttgacatggtagaacat
tctcgggtacctgtttgcatttttggctgcacaacgaaattaaatatcttggaatattta
gaaaagagggtaaagagtagattttctcaaagagtgatttatatgccgcaaatacagaat
ctagacgatatggttgacgccgtcagaaatttacttacagttcgctctgaaatctccccc
tgggtttcacaatggaatgaaacgttggaaaaagaactatccgaccctcgatcgaatttg
aatagacatattaggatgaatttcgaaacctttaggtcattacctacattgaaaaatagc
ataattccattagtagcgacatccaaaaattttggttcactctgcactgccataaaatcg
tgttcttttcttgacatatacaataagaaccaactatctaataatttaacaggaaggctc
caatctttatccgatttagagttagccattttgatctcagccgctagggttgccttaagg
gcgaaagacggatcttttaattttaatttagcttatgcagagtatgaaaagatgattaaa
gctatcaactccagaattcccaccgtggctcctactacaaatgtgggaacaggtcaaagt
actttttctatcgacaatactatcaaactatggttgaaaaaggacgtcaagaacgtttgg
gaaaatttagtgcaactggatttttttaccgagaaatcagccgttggtttgagagataat
gcgaccgcagcattttacgctagcaattatcaatttcagggcaccatgatcccgtttgac
ttgagaagttaccagatgcagatcattcttcaggaattaagaagaattatccccaaatct
aatatgtactactcctggacacaactgtga

DBGET integrated database retrieval system