KEGG   Saccharomyces cerevisiae (budding yeast): YPR184WHelp
Entry
YPR184W           CDS       T00005                                 

Gene name
GDB1
Definition
bifunctional 4-alpha-glucanotransferase/amylo-alpha-1,6-glucosidase (EC:3.2.1.33 2.4.1.25)
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YPR184W (GDB1)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     YPR184W (GDB1)
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     YPR184W (GDB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XVI:902044..906654
Genome map
AA seq 1536 aa AA seqDB search
MNRSLLLRLSDTGEPITSCSYGKGVLTLPPIPLPKDAPKDQPLYTVKLLVSAGSPVARDG
LVWTNCPPDHNTPFKRDKFYKKIIHSSFHEDDCIDLNVYAPGSYCFYLSFRNDNEKLETT
RKYYFVALPMLYINDQFLPLNSIALQSVVSKWLGSDWEPILSKIAAKNYNMVHFTPLQER
GESNSPYSIYDQLQFDQEHFKSPEDVKNLVEHIHRDLNMLSLTDIVFNHTANNSPWLVEH
PEAGYNHITAPHLISAIELDQELLNFSRNLKSWGYPTELKNIEDLFKIMDGIKVHVLGSL
KLWEYYAVNVQTALRDIKAHWNDESNESYSFPENIKDISSDFVKLASFVKDNVTEPNFGT
LGERNSNRINVPKFIQLLKLINDGGSDDSESSLATAQNILNEVNLPLYREYDDDVSEILE
QLFNRIKYLRLDDGGPKQGPVTVDVPLTEPYFTRFKGKDGTDYALANNGWIWNGNPLVDF
ASQNSRAYLRREVIVWGDCVKLRYGKSPEDSPYLWERMSKYIEMNAKIFDGFRIDNCHST
PIHVGEYFLDLARKYNPNLYVVAELFSGSETLDCLFVERLGISSLIREAMQAWSEEELSR
LVHKHGGRPIGSYKFVPMDDFSYPADINLNEEHCFNDSNDNSIRCVSEIMIPKILTATPP
HALFMDCTHDNETPFEKRTVEDTLPNAALVALCSSAIGSVYGYDEIFPHLLNLVTEKRHY
DISTPTGSPSIGITKVKATLNSIRTSIGEKAYDIEDSEMHVHHQGQYITFHRMDVKSGKG
WYLIARMKFSDNDDPNETLPPVVLNQSTCSLRFSYALERVGDEIPNDDKFIKGIPTKLKE
LEGFDISYDDSKKISTIKLPNEFPQGSIAIFETQQNGVDESLDHFIRSGALKATSSLTLE
SINSVLYRSEPEEYDVSAGEGGAYIIPNFGKPVYCGLQGWVSVLRKIVFYNDLAHPLSAN
LRNGHWALDYTISRLNYYSDEAGINEVQNWLRSRFDRVKKLPSYLVPSYFALIIGILYGC
CRLKAIQLMSRNIGKSTLFVQSLSMTSIQMVSRMKSTSILPGENVPSMAAGLPHFSVNYM
RCWGRDVFISLRGMLLTTGRFDEAKAHILAFAKTLKHGLIPNLLDAGRNPRYNARDAAWF
FLQAVQDYVYIVPDGEKILQEQVTRRFPLDDTYIPVDDPRAFSYSSTLEEIIYEILSRHA
KGIKFREANAGPNLDRVMTDKGFNVEIHVDWSTGLIHGGSQYNCGTWMDKMGESEKAGSV
GIPGTPRDGAAIEINGLLKSALRFVIELKNKGLFKFSDVETQDGGRIDFTEWNQLLQDNF
EKRYYVPEDPSQDADYDVSAKLGVNRRGIYRDLYKSGKPYEDYQLRPNFAIAMTVAPELF
VPEHAIKAITIADEVLRGPVGMRTLDPSDYNYRPYYNNGEDSDDFATSKGRNYHQGPEWV
WLYGYFLRAFHHFHFKTSPRCQNAAKEKPSSYLYQQLYYRLKGHRKWIFESVWAGLTELT
NKDGEVCNDSSPTQAWSSACLLDLFYDLWDAYEDDS
NT seq 4611 nt NT seq  +upstreamnt  +downstreamnt
atgaatagatcattactgctacgtttgtcggataccggtgaacccattacaagctgctct
tacggaaaaggtgtcttgacgctaccaccaattccgctccctaaggacgccccaaaggac
caaccgctctatacggtcaagctactggtatctgcaggttcccctgtcgctagggatggg
ctagtttggactaattgcccaccagatcacaacacgcccttcaagagggacaaattttac
aaaaaaatcattcattccagctttcacgaggatgactgcattgacctgaatgtctacgct
ccaggctcgtactgcttttatctatctttcaggaacgataacgaaaaacttgagacaaca
aggaaatactactttgttgccttgcccatgctttatataaacgatcagttcctacctttg
aattccatcgctttacaaagtgttgtatcgaaatggctgggctctgactgggagcccatc
ctatcgaaaattgccgctaaaaactacaatatggtacatttcacccctctacaggaaaga
ggcgagtctaactcgccttactctatatacgaccaattgcagttcgaccaggaacacttt
aagtctcctgaagacgtgaaaaatttagttgagcatatacatcgcgatttaaacatgctt
tcattaacagatattgtttttaaccacacagctaataattctccttggttagttgagcac
ccggaggctgggtataaccacatcactgcgccacatctaatcagcgccatagagctcgac
caagaattgctcaattttagtaggaatttgaaatcctggggctatcctaccgaactgaaa
aatatagaagatctcttcaagatcatggacggtattaaagtgcatgttttagggtcgttg
aaactgtgggaatattatgcggtaaacgtgcaaacagctcttcgggatatcaaagcccat
tggaatgacgaatctaacgaaagttacagttttcccgagaatattaaagacatctcgtcc
gatttcgtaaaactagcttcctttgtgaaggacaacgtcactgagcctaacttcggcact
cttggtgaaagaaactcaaacaggattaacgtgccaaaatttattcaactactgaagctc
attaacgatggtggtagtgatgacagtgaatcttcgttggccacggctcaaaacatcttg
aacgaggtcaacttacccttatatagagaatacgacgatgatgtcagtgagatactcgag
caactgttcaatcgtatcaaatatttgagattagatgacggtgggcccaagcaaggtcca
gtgaccgttgacgtgcccttaacagagccttattttacgaggttcaaaggaaaagatggt
actgattatgccctcgccaacaatggctggatatggaatggtaacccactagtggatttt
gcatcgcagaattcaagagcttatttacgtagagaagttatcgtgtggggggactgtgtc
aagttaagatacggtaaaagccctgaagactctccgtatctgtgggaaagaatgtccaag
tatatagaaatgaacgccaagatatttgacgggttcagaattgacaactgccattctact
ccaatacatgttggcgaatatttcctagatttggcaagaaaatacaacccgaacctatat
gtcgttgcagagctgttttctggttccgaaacactagattgtctgtttgttgaacggttg
ggtatctcctctttaatcagagaggcaatgcaagcctggtccgaagaagagttgtctaga
ttagtccataagcatggcgggaggcccattggctcctataagtttgttcctatggatgac
ttctcatatcctgcggatattaatttaaacgaggagcattgtttcaacgactccaacgat
aactccataagatgtgtatcagagatcatgattccaaagattttaaccgccactccgcca
cacgctttattcatggactgtacccatgataatgaaactccctttgaaaaaagaacagtg
gaggatactttgcccaatgctgcattggtggctctttgctcgtccgccattggatctgtt
tatggctacgacgaaatttttccacatttactgaatttggtcactgaaaaaagacattat
gacatttctacgcctactggtagcccctcgataggaataaccaaagtcaaggccactttg
aattcgattagaacgagtataggagaaaaggcgtatgacattgaagactcagaaatgcat
gtgcatcaccagggccagtacattacttttcatcgtatggatgttaaatccggaaaaggt
tggtacttgatagcaaggatgaaattttctgacaatgatgaccctaacgagactttacca
ccagtggtgttaaaccaatccacctgttctctcaggttttcgtatgctttggaaagagtt
ggcgatgaaattcccaacgacgataaattcattaaaggtattcccacgaaattaaaggag
cttgaagggtttgacatttcttatgatgattctaagaagatttcaacgataaaactgccc
aatgaattccctcaaggatctattgccatttttgagacccaacagaatggtgtggacgaa
tccttagatcattttataaggtcaggtgctttaaaggccacttcaagtttgactctagag
tcaataaattccgtcttgtatcgtagtgagccggaagaatacgatgttagcgccggcgaa
ggtggtgcttatattattcctaattttggaaagcctgtgtattgtggtctgcaaggttgg
gtttccgtattaagaaaaattgtgttttacaatgatttagcacatcccctcagtgcaaat
ttaagaaatggacattgggctttagactacactatcagtagacttaattactatagcgat
gaagcaggaatcaatgaagtgcagaactggctgcgttcaaggtttgatagagtgaaaaag
ttaccgagctacttagtgcccagttatttcgccttaattatcggcatcctctatggttgt
tgtcgcttaaaagcaatacagctaatgtcccgtaatattggtaaatctacattgtttgta
caaagcttatctatgacatcaatccagatggtttccagaatgaagtcaacctctatttta
ccaggcgaaaatgttccatctatggctgcagggttgccacactttagcgtaaactacatg
agatgttgggggagagatgtattcatatcgctaagaggtatgctattaacaacaggtaga
tttgatgaagctaaagctcatatactagcctttgcaaagactttgaagcatggtttaatt
ccaaacttgctggatgccggtagaaacccgagatataatgctcgtgatgctgcctggttc
ttcttgcaagctgtacaggattatgtttatattgttcctgatggcgaaaaaatattacaa
gagcaagtaacaaggagattcccactggatgatacttacattcctgtagatgatccaagg
gcatttagttactctagtaccttggaggagatcatttatgaaattttgagtaggcatgcc
aagggaattaaattcagagaggctaatgcaggtccaaatttagatcgtgttatgactgat
aaagggtttaatgttgaaattcatgtcgattggtcgactggcttaattcatggtggatct
cagtataactgtggtacttggatggataagatgggtgaaagtgaaaaagcagggtctgtt
ggtattcctggaacacccagagatggagccgcaatagaaatcaatgggcttttaaaaagt
gctttaaggtttgttattgaactaaaaaacaagggattgtttaagttttccgatgtggag
acgcaggacggcgggaggatcgatttcactgaatggaatcaattacttcaagacaatttc
gaaaaaagatattatgttccggaggatccatcacaggatgcagattatgacgtgagcgct
aaattgggtgttaatagacgggggatatacagagatttgtacaaatcaggaaagccttat
gaagattatcagttaagaccaaattttgctattgccatgactgtggcaccagagttattt
gtgcctgagcatgccataaaagcaatcaccattgcagatgaagtcttaagaggtccagta
ggtatgcgtactttagacccaagcgattacaattaccgtccgtactacaacaacggagaa
gattcggatgattttgccacctcaaagggtagaaactatcaccaaggccctgagtgggtc
tggctttacggctactttttaagagcgttccatcatttccactttaaaaccagtccacgt
tgtcagaatgctgccaaagagaaaccatcctcttatttgtatcaacaattatactacaga
ttaaaaggccatagaaaatggatttttgaaagtgtgtgggcaggattgacagagctaacc
aataaagatggtgaagtatgcaatgactcaagccccacgcaagcctggagttctgcttgt
ttgttagatctattttatgatttatgggatgcctacgaagatgattcctga

DBGET integrated database retrieval system