KEGG   Streptococcus parasanguinis FW213: Spaf_0045Help
Entry
Spaf_0045         CDS       T02115                                 

Gene name
bgaC
Definition
Beta-galactosidase 3
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:scf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Spaf_0045 (bgaC)
Enzymes [BR:scf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Spaf_0045 (bgaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
55004..56791
Genome map
AA seq 595 aa AA seqDB search
MDVFEIRDDFYLKGQPFKILSGAIHYFRIDPADWYHSLFNLKALGFNTVETYVPWNVHEP
RKGQFDFSGRLDLERFIQIAQSLGLYMIVRPSPFICAEWEFGGLPAWLLEEDMRIRSSDP
AFIEAVDRYYDHLLGLLTRYQVDQGGPILMMQVENEYGSYGEDKVYLRAIRDLMKKKGVT
CPLFTSDGPWRATLRAGTLIEDDLFVTGNFGSKAAYNFGQMQEFFDEYGKKWPLMCMEFW
DGWFTRWKEPVIQREPEELAEAVHEVLELGSINLYMFHGGTNFGFMNGCSARGTLDLPQV
TSYDYGALLNEQGNPTEKYYAIQKMMATYYPEYPQQEPLIKECLPEQTLQLVAKTSLFGN
LDNLAQVETSLYPEKMEELGQTTGYLLYETDLELDAEEERLRVIDGRDRVQIYLDDRHVA
TQYQTEIGEDLFIKGKKKAVTNLKILLENMGRVNYGHKLLADSQHKGIRTGVCVDLHFHL
HWKQYPLDLQDLSQLDFSKEWQAGAPAFYRYDFQLDQTLDTYLDMTGFGKGVAFVNGHNL
GRFWEVGPTTSLYVPHGFLKEGANSLIVFETEGRYQETLQLVQQPTFKEVKGESL
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggatgtttttgaaattcgcgatgatttctatttaaaaggtcaacctttcaagattttg
tctggagcgattcattattttcgaattgatcctgctgactggtatcattccttgtttaat
ctaaaggccttggggttcaacacggttgagacttatgtgccatggaacgtgcatgaaccc
cgcaaagggcagtttgactttagtggtcgattggatctagagcgtttcattcaaatagcc
cagtccctaggactttacatgattgtaagaccgtcgccctttatctgtgcagagtgggaa
tttggtggattgccagcctggctcttggaagaagatatgcgtatccgctcatcggaccca
gcctttatcgaagcggttgatcgttattatgatcacttgcttgggttgttgacgcgctac
caagtggatcagggtggtccaattctgatgatgcaggttgaaaatgaatatggctcttat
ggagaggacaaagtttatctgcgtgccattcgggatttgatgaagaaaaaaggtgtgacc
tgtcccctctttacatcagatggtccatggcgagcgacgctaagagcaggaaccttgatc
gaagatgacctctttgtgacagggaacttcggctcaaaagcagcttacaattttggccag
atgcaagaattttttgacgaatacggcaagaaatggcccttgatgtgtatggaattctgg
gatggctggtttacccgctggaaggaacccgtgattcaaagggagccagaggagttggca
gaagctgtacatgaggtcttggagcttggctccatcaatctctatatgtttcatggcgga
accaatttcggctttatgaatggttgctcagctcggggaacgctcgatttgccacaggtg
acgtcctatgactatggggctttgctcaatgagcagggcaatccgacagagaagtattat
gctattcaaaaaatgatggcgacctattatccggaatacccacagcaagaaccgctcatc
aaagagtgtttgccagaacaaaccttgcaattggtagccaagactagtctttttgggaat
ctggacaatttggctcaggtcgagaccagcctctatcccgaaaagatggaagagttgggg
cagaccacaggttatctactatatgagacagaccttgagttggatgcggaagaagaaaga
ctgcgcgtcattgatggtcgggatcgggtacaaatttatctagatgatcgccatgtagca
acacaataccaaacagagatcggtgaagatctttttatcaaaggaaaaaagaaagcggtt
acgaatttaaaaatcttgcttgagaatatgggacgtgtcaactacgggcacaagctctta
gctgatagccagcacaagggcattcgcacaggtgtctgtgtggatttgcatttccacctt
cattggaagcagtacccactggatttacaagatctcagtcagctcgatttttcaaaggaa
tggcaggcaggtgctccagctttttaccgatatgattttcagctggaccaaacccttgac
acctatctagatatgacaggatttggaaagggggttgcctttgtcaacggccacaacctt
ggtcgcttctgggaggtcggaccgaccacttcactttatgtgcctcatggcttcctcaaa
gaaggagccaatagcctaatcgtctttgagacagaagggcggtaccaagagacacttcaa
cttgttcaacaacctacattcaaagaagtaaagggggaaagcttatga

DBGET integrated database retrieval system