KEGG   Streptococcus parasanguinis FW213: Spaf_0058Help
Entry
Spaf_0058         CDS       T02115                                 

Gene name
adhE
Definition
(RefSeq) iron-containing alcohol dehydrogenase
  KO
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:scf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Spaf_0058 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spaf_0058 (adhE)
   00620 Pyruvate metabolism
    Spaf_0058 (adhE)
   00650 Butanoate metabolism
    Spaf_0058 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    Spaf_0058 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Spaf_0058 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Spaf_0058 (adhE)
   00626 Naphthalene degradation
    Spaf_0058 (adhE)
Enzymes [BR:scf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Spaf_0058 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Spaf_0058 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
67077..69728
Genome map
AA seq 883 aa AA seqDB search
MADKKTLSPEEKKLAAEKHVDELVQKALVALEEMRKLNQEQVDYIVAKASVAALDAHGEL
ALHAYEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGVISEDDVTGLTLIAEPVGVVCG
ITPTTNPTSTAIFKALISLKTRNPIVFAFHPSAQESSAHAAQIVRDAAIAAGAPENCVQW
ITQPSMEATSALMNHEGVATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQ
AAHDIVMSKSFDNGMVCASEQAVIIDKEIYDEFVEEFKSYHTYFVNKKEKALLEEFCFGV
KANSKNCAGAKLNADIVGKPAAWIAEQAGFSVPEGTNILAAECKEVGEKEPLTREKLSPV
IAVLKSESREDGINKARQMVEFNGLGHSAAIHTADEELTKEFGKAVKAIRVICNSPSTFG
GIGDVYNAFLPSLTLGCGSYGRNSVGDNVSAINLLNIKKVGRRRNNMQWMKLPSKTYFER
DSIEYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFADVEPDPDITTV
ERGTEIMRAFKPDTIVALGGGSPMDAAKVMWLFYEQPEVDFRDLVQKFMDIRKRAFKFPL
LGKKTKFIAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPGF
VAADTGMDVLTHATEAYVSQMASDYTDGLALQAIKLVFENLESSVKNADFHSREKMHNAS
TIAGMAFANAFLGISHSMAHKIGAQFHTIHGRTNAILLPYVIRYNGTRPAKTATWPKYNY
YRADEKYQDIARMLGLPCSTPEEAVEAYAKAVYELGERCGIEMNFKAQGIDEKEWKKHSR
ELAFLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYKERPGRRK
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaaaaactctctcacctgaagaaaagaaactcgctgctgaaaaacacgta
gacgagttggtgcaaaaagcgctggtggcgcttgaagaaatgcgcaaattgaatcaggaa
caagtggactacattgtggcgaaagcatctgtagctgctcttgacgcacacggtgaactc
gctcttcatgcatatgaagaaactggtcgtggggtctttgaagacaaagcgaccaagaac
ttgttcgcttgtgaacacgttgtgaacaacatgcgtcacacgaagacagttggtgtcatt
tcagaagatgacgtcactggtttaactttgattgcagagccagtcggagttgtctgcggg
atcactcctacaacaaaccctacttcaacagcaatctttaaagcattgatttccttgaag
acacggaaccctatcgtctttgccttccacccatctgctcaagaatcatcagctcatgcg
gcacaaatcgtacgcgatgcggcaattgcagctggagcacctgagaactgtgtgcaatgg
attacccaaccttctatggaagcaaccagtgcccttatgaaccatgaaggagttgctacg
atccttgcgaccggtggtaacgccatggtgaaagcggcttattcttgtggaaaaccagct
cttggggtaggtgccggaaacgtacctgcttatgttgaaaaatcagctaatatccgccaa
gcagcacacgatatcgtcatgtctaaatcatttgacaacggaatggtttgtgcgtctgaa
caagcggtcatcatcgataaagaaatctacgatgagtttgttgaagaattcaaatcttac
cacacttactttgtcaacaaaaaagaaaaagcccttcttgaagagttctgcttcggcgta
aaagcgaacagcaagaactgcgcgggtgcgaaattgaatgcggacatcgttgggaaacca
gcagcatggatcgcagaacaagctggcttctctgtaccagaaggaaccaatatccttgcg
gcagaatgtaaagaagttggtgaaaaagaaccgttgactcgtgaaaaattgtcaccagtt
atcgctgttttgaaatctgaaagccgtgaagacggaattaacaaagctcgccaaatggtt
gaattcaacggtcttggtcactcagcagccatccatactgctgatgaagaattgaccaaa
gaatttggtaaagcagtcaaagctattcgtgttatctgcaactctccttcgactttcggt
ggtatcggggatgtttacaatgccttcttgccatcattgacacttggatgtggttcttac
ggacgcaactctgttggggacaacgttagtgccatcaacctcttgaatatcaaaaaagtc
ggacgccggagaaataacatgcaatggatgaaacttccttcaaaaacatactttgaacgt
gattcaattgaatacctacaaaaatgtcgtgacgttgaacgtgtcatgatcgttacagac
cacgctatggtagagcttggtttccttgatcgtatcatcgaacagcttgaccttcgtcgc
aacaaggtggtttaccaaatctttgcagacgtagaaccagatccagatatcacaaccgtt
gaacgtggtacagagatcatgcgtgccttcaaaccagataccatcgtcgctcttggtggt
ggatctccaatggatgcggctaaagtaatgtggctcttctatgaacaaccagaagtggac
ttccgtgaccttgtacaaaaattcatggatattcgtaaacgtgccttcaagttcccattg
cttggtaagaagaccaaatttatcgctatcccaactacatctggtacaggatctgaagta
actccatttgccgttatctctgataaagcaaacaaccgtaaatacccaatcgctgactac
tcattgacaccaaccgttgccatcgtagaccctgccttggtattgacagttcctggattt
gtagctgctgatactggtatggacgtattgactcacgctactgaagcttacgtatcacaa
atggcaagtgactacactgatggtcttgctcttcaagccatcaaacttgtctttgaaaac
ttggaaagctcagtcaagaatgcggacttccattcacgtgaaaagatgcacaatgcgtca
acgatcgcaggtatggccttcgccaatgccttcctcggtatttctcactcaatggcccac
aagatcggtgcgcaattccacaccatccacggacggaccaatgcgatcttgcttccatac
gttatccgctacaacggtacacgcccagccaagacagctacatggcctaagtacaactac
taccgtgcagatgaaaaataccaagatatcgctcgtatgctaggacttccatgctctact
ccagaagaagccgttgaagcttacgcaaaagctgtatacgaactcggtgaacgctgtggt
atcgaaatgaacttcaaagcacaaggaatcgatgaaaaagaatggaagaaacattctcgt
gaattggccttccttgcttacgaagatcaatgttcaccagctaacccacgtcttccaatg
gtagaccatatgcaagaaatcatcgaagatgcatactatggttacaaggaacgtccagga
cgtcgtaaataa

DBGET integrated database retrieval system