KEGG   Streptococcus parasanguinis FW213: Spaf_0100Help
Entry
Spaf_0100         CDS       T02115                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:scf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spaf_0100 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spaf_0100 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Spaf_0100 (thrC)
Enzymes [BR:scf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Spaf_0100 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
112423..113907
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDEKNTVTASQAILQGLATDGGLFTPVSYPQVELDFDTLKDASYQEVAKLVL
SAFLDDFTAEELDYCISHAYDSKFDTPAIAPLVKLDGQYNLELFHGSTIAFKDMALSILP
YFMTTAAKKHGLENKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPKDGVSKVQELQMT
TQTGDNTHVIAIDGNFDDAQTNVKHMFNDVALREKLAANKMQFSSANSMNIGRLVPQVVY
YVYAYAQLVKTGQITAGEKVNFTVPTGNFGNILAAFYAKQIGLPVGKLICASNENNVLTD
FFKTHVYDKKREFKVTTSPSMDILVSSNLERLIFHLVGNDATKTKELMESLVATGQYQLS
NFDADILDLFAAAYADEAETAAEIKRVYEASDYIEDPHTAVASAVYQKYRTQTGDTAKTV
IASTASPYKFPVVAVEAVTGETGLGDFEALAKLHTLSGVPVPPAVDGLETAPVRHRTSVA
AKDMQAAVEDYLGL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacattagtttaccaatcaacacgagatgaaaaaaatactgtaacagctagtcaagct
atccttcaaggattggcgacagatggcggtttgtttactccagtctcttatcctcaagta
gagctggattttgataccctcaaagacgcttcttaccaagaagtagccaagcttgttttg
tcagcctttttggatgactttacagcagaagagttagactactgtatttctcatgcttat
gacagcaagtttgataccccagccattgctccgcttgtcaaactcgatggacaatacaac
ttggagctcttccacggttccaccattgcctttaaagatatggctttgtcgatcttgcct
tactttatgacaacagcagctaaaaagcacggtttggaaaataaaattgtcatcttgacg
gcgacttctggagatacaggaaaagctgctatggcaggttttgctgatgttccagggaca
gagatcattgtcttttatccaaaagatggtgtcagcaaggtgcaagaattgcaaatgacg
actcaaactggggacaatacccatgtcatcgccatcgatggaaactttgacgatgcccaa
accaatgtcaaacacatgttcaatgatgtggcgcttcgtgaaaaattagcagccaacaag
atgcaattttcatcagctaactctatgaacattggtcgtttggtgcctcaggttgtctat
tacgtatacgcctatgcgcaattggtaaagacaggccaaatcacagcgggagaaaaagtc
aactttaccgtcccaacaggaaactttggaaatatcttagcagctttctatgctaaacaa
atcggtcttccagttgggaaattgatctgtgcgtcaaatgaaaacaatgtcttgacagac
ttcttcaaaacacatgtctatgataagaaacgtgagttcaaggtgaccactagcccatca
atggatattttagtctcttcaaacttggaacgcttgattttccacttggtaggcaatgat
gccacaaagactaaagagttgatggaaagcctcgttgcaacaggtcagtaccagttgtcc
aactttgatgcagatatcttagatttgtttgcggctgcatacgcagatgaagcagaaact
gctgcagagatcaagcgggtctatgaagcgtctgattacatcgaagaccctcatacagcc
gtagcatcagccgtttatcaaaaataccggactcaaacaggagatactgctaaaacagtt
attgcctctacagcaagtccttacaaattcccagttgttgcagtagaagcggtgacaggt
gagacaggtctaggcgatttcgaagccttggctaaattacacacactctcaggtgttcct
gtgccaccggctgtagacggccttgaaactgcaccggttcgccatcgtacaagcgtggca
gccaaagacatgcaagcagccgtagaagactacttgggactttaa

DBGET integrated database retrieval system