KEGG   Streptococcus parasanguinis FW213: Spaf_0110Help
Entry
Spaf_0110         CDS       T02115                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain, putative
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:scf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spaf_0110 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spaf_0110 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Spaf_0110 (trpB)
Enzymes [BR:scf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Spaf_0110 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
121680..122885
Genome map
AA seq 401 aa AA seqDB search
MAYKQPDKNGFYGRFGGRFVPETLMTAVLELEEAYRESQADPSFQAELDQLLKQYVGRET
PLYYAKNLTKYVGGAKIFLKREDLNHTGAHKINNALGQVLLAHRMGKKKIIAETGAGQHG
VATATAAALFDMECTIYMGEEDVKRQALNVFRMELLGAKVQSVTDGSRVLKDAVNAALRA
WVANVEDTHYIMGSALGPHPFPEIVRDFQSVIGREAKRQFAEQNDGALPDAVLACVGGGS
NAIGLFYPFVEDASIAMYGAEAAGLGVDTDQHAATLTKGRPGVLHGALMDVLQDAHGQIL
EAFSISAGLDYPGIGPEHSYFHDIKRATYVPVTDQEALEAFQLLSKVEGIIPALESSHAI
AYAVKLAKEMGPEKSMIVCLSGRGDKDVVQVKDRLEKERGE
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggcatataaacaaccagataaaaacggattttacgggcggttcgggggacgatttgtc
cctgaaaccttgatgacagcagttttagaattagaagaagcctatagagaaagtcaagca
gatccttcttttcaagcagaattggatcagcttctgaaacaatatgtcggtcgggaaaca
ccgctctattacgctaagaatctaaccaagtatgttggtggagccaagatttttcttaaa
agagaagacctcaaccacacaggggctcataaaattaataatgctctaggacaggttttg
ttggcacaccggatgggcaaaaagaagatcatcgcagaaacaggggccggacagcacggt
gttgcaacagcaacagctgctgctttatttgatatggaatgtaccatctacatgggggaa
gaagatgtcaaacgccaagccctcaatgtctttcggatggaattgttgggcgccaaggtt
caatcagtaacagatgggtcacgggttctcaaggatgcggtcaatgctgcccttagagcc
tgggtagcaaatgtggaggatacccactatatcatggggtctgctctagggcctcatcca
ttcccagagattgtccgtgattttcaaagtgtcatcggtcgagaagccaaacgccaattt
gcagagcaaaatgatggtgcgctaccagatgcagtcttagcctgtgtaggaggcggatcg
aacgccattgggctcttttatccttttgttgaggatgcctctattgccatgtatggggcg
gaagctgctggccttggggtagatacagaccagcatgcagcaaccttaaccaagggacgt
ccgggagtccttcacggcgccttgatggatgttttacaggatgcccatggacagatttta
gaagccttctcgatttcggcaggtctcgattatccagggattgggccagagcattcttat
ttccatgacatcaagcgggcaacctatgtgcctgtgacagaccaagaagccctagaagcc
tttcaattgctttcgaaagtagaaggaatcattccagctctggaatcgagccatgctatc
gcctatgcggtgaagttggctaaggagatgggacctgaaaaatctatgattgtttgctta
tcaggtcgtggggataaagatgtggtacaagtcaaagaccgcctagaaaaagagagagga
gagtaa

DBGET integrated database retrieval system