KEGG   Streptococcus parasanguinis FW213: Spaf_0112Help
Entry
Spaf_0112         CDS       T02115                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:scf01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:scf00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:scf00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
122887..123663
Genome map
AA seq 258 aa AA seqDB search
MGKTLTEHLQKLKDQQQGIFVPYIMAGDHEKGLAGLQETIQFLEELGVSAIEVGIPFSDP
VADGPVIEEAGLRSLAHGTTTEELVQTIQHLETSVPLVIMTYFNPLFQYGLENFFRDVEG
PAVKGVIIPDLPHEHANLVEPLLADKDIALVPLVSLTTGIERQKKLIQDAEGFIYAVAVN
GVTGKAGSYRDDLDHHLAQLHEIASIPVLTGFGVSSMEDVHRFNKVSDGVIVGSKIVKAL
HRGETDAIARFISQAVKG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagaccttaacagagcatttacaaaagctgaaagaccagcagcaagggatcttt
gttccttatattatggcaggagatcatgaaaaaggcttggcaggtttgcaggaaaccatc
caatttttggaggaacttggtgtctcagctattgaggttggcattcctttttcggatccg
gtggcagatggtcctgtgattgaagaggcgggactacgaagtttagcccatgggacgacg
acagaggaactggtgcaaacgatccagcacttagagacaagtgttcctttggtcatcatg
acctatttcaaccccttgttccaatatggtctagaaaacttttttagagatgtagaagga
ccagcagtcaaaggagtgattattccggacctcccccatgagcatgcgaatttggtagag
cctctattagcggataaagacatcgctttggtgccactagtgagcctaaccacaggaatc
gagcgccaaaagaaattgatccaagatgcagaaggatttatctatgccgttgctgtcaat
ggagtgacggggaaagctggtagctatcgagatgatttggatcaccacttggcccaatta
cacgaaatagcatccattcctgttttaacaggttttggggtttccagcatggaggatgtt
caccgtttcaacaaggtctcagatggggttattgtggggtctaaaatcgttaaggctctc
caccgaggggagacagacgccatcgctcgttttatttctcaagcagtgaagggctag

DBGET integrated database retrieval system