KEGG   Streptococcus parasanguinis FW213: Spaf_0112Help
Entry
Spaf_0112         CDS       T02115                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:scf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spaf_0112 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spaf_0112 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Spaf_0112 (trpA)
Enzymes [BR:scf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Spaf_0112 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
122887..123663
Genome map
AA seq 258 aa AA seqDB search
MGKTLTEHLQKLKDQQQGIFVPYIMAGDHEKGLAGLQETIQFLEELGVSAIEVGIPFSDP
VADGPVIEEAGLRSLAHGTTTEELVQTIQHLETSVPLVIMTYFNPLFQYGLENFFRDVEG
PAVKGVIIPDLPHEHANLVEPLLADKDIALVPLVSLTTGIERQKKLIQDAEGFIYAVAVN
GVTGKAGSYRDDLDHHLAQLHEIASIPVLTGFGVSSMEDVHRFNKVSDGVIVGSKIVKAL
HRGETDAIARFISQAVKG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagaccttaacagagcatttacaaaagctgaaagaccagcagcaagggatcttt
gttccttatattatggcaggagatcatgaaaaaggcttggcaggtttgcaggaaaccatc
caatttttggaggaacttggtgtctcagctattgaggttggcattcctttttcggatccg
gtggcagatggtcctgtgattgaagaggcgggactacgaagtttagcccatgggacgacg
acagaggaactggtgcaaacgatccagcacttagagacaagtgttcctttggtcatcatg
acctatttcaaccccttgttccaatatggtctagaaaacttttttagagatgtagaagga
ccagcagtcaaaggagtgattattccggacctcccccatgagcatgcgaatttggtagag
cctctattagcggataaagacatcgctttggtgccactagtgagcctaaccacaggaatc
gagcgccaaaagaaattgatccaagatgcagaaggatttatctatgccgttgctgtcaat
ggagtgacggggaaagctggtagctatcgagatgatttggatcaccacttggcccaatta
cacgaaatagcatccattcctgttttaacaggttttggggtttccagcatggaggatgtt
caccgtttcaacaaggtctcagatggggttattgtggggtctaaaatcgttaaggctctc
caccgaggggagacagacgccatcgctcgttttatttctcaagcagtgaagggctag

DBGET integrated database retrieval system