KEGG   Streptococcus parasanguinis FW213: Spaf_0223Help
Entry
Spaf_0223         CDS       T02115                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:scf00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
226653..227285
Genome map
AA seq 210 aa AA seqDB search
MADRGLLIVFSGPSGVGKGTVRREIFENSDNQFQYSVSMTTRAQRPGEVDGVDYFFRTRE
EFEDLIRQGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIEVQGALQVKKKVPDAVF
IFLTPPDLDELQDRLVGRGTDSAEVIAQRIEKAKEEIAMMREYDYAIVNDEVPLAAERVK
RVIEAEHFRVDRVIGHYLDMLPKTHTIVTR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggcggatcgtggcttattaatcgtattttctggcccttcgggggttggaaaaggtacg
gtcagacgagaaatttttgaaaactcagataatcagtttcaatactctgtatcgatgaca
acgcgtgcgcaacgtccaggtgaagtggatggtgtcgactattttttccgtacacgtgaa
gaatttgaagatttaatccgtcaaggacaaatgttagaatatgctgagtacgttgggaat
tactatggaactcctctgacttatgtgaatgaaaccttggacaaaggaattgatgtattc
cttgaaattgaagttcagggtgcgctccaagtgaagaagaaagtacccgatgcagttttt
atcttcttaacaccacctgatttggatgaattgcaagatcgattggtgggacgtggaaca
gatagtgcagaagtgattgcgcaacggattgagaaagccaaagaagaaatcgctatgatg
cgtgaatatgactacgcgattgttaatgatgaagtccctcttgcagctgagcgtgtgaag
cgtgtgatcgaagctgagcacttccgtgtagatcgtgttattggtcattatctggatatg
ttacctaaaacacatacaattgtgacgagataa

DBGET integrated database retrieval system