KEGG   Streptococcus parasanguinis FW213: Spaf_0248Help
Entry
Spaf_0248         CDS       T02115                                 

Definition
phosphoglycerate mutase family protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:scf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spaf_0248
   01230 Biosynthesis of amino acids
    Spaf_0248
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spaf_0248
  Energy metabolism
   00680 Methane metabolism
    Spaf_0248
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spaf_0248
Enzymes [BR:scf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Spaf_0248
Exosome [BR:scf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Spaf_0248
  Exosomal proteins of melanoma cells
   Spaf_0248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
256804..257358
Genome map
AA seq 184 aa AA seqDB search
MNNSYILLRHAHSRFSSDDFNRTLSEKGFASLKQLEFLNSFNIDYYFSSPFKRAFETVNS
SPVQFDKIVLDDRLRERKLSSRFIEDSEFEETIQYLWQNPDKSLIGGESNREALKRILDL
IEDLEERYSDKTILLSSHGNLLGILINHFDPSFDYKKWEQMTFPDCFLVEKDESVKRIME
VTSG
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaacaattcttatattttacttagacatgctcattcgagattttcgagtgatgatttt
aatagaactttatcggaaaaaggatttgcatctcttaagcagttggagtttttgaattct
tttaatattgattactatttttctagtccttttaagcgagcttttgagacagtaaatagt
tctcctgtacaatttgataagatagtgcttgatgatcgtttacgtgaaagaaaattatcc
tcaagatttattgaagattctgagtttgaagaaacgattcaatatttatggcaaaatcca
gataaatcacttattggaggtgagtctaatcgagaagcattaaagagaatcctagatttg
atagaggacttggaagaaagatactcagataaaaccattttactaagctctcatggaaat
ttgttaggaatcttaatcaatcattttgatccaagttttgattataaaaaatgggaacag
atgacttttccagattgctttctagttgaaaaagatgagagtgtgaaaagaattatggaa
gttacttctgggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system