KEGG   Streptococcus parasanguinis FW213: Spaf_0295Help
Entry
Spaf_0295         CDS       T02115                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Spaf_0295 (folP)
Enzymes [BR:scf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Spaf_0295 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
310063..311013
Genome map
AA seq 316 aa AA seqDB search
MIDNKWLSGQGTLLCGILNVTPDSFSDGGKYTSVDAALQQARKLIQEGAQLLDIGGESTR
PGSHYVEIQEEIDRVVPVIKAIRKESDVLISVDTWKSQVAAAALEAGADIVNDITGFLGD
PKMAAVVAEHEASAVLMFNPVMARPHHPSSTIFPRFGFEPVFSEQELQQMAQEPIQDLMW
TFFNRSLAVAKAAGVQTDRIMLDPGIGFGLTKRENLLLLQELGTIHQKGYPIFLGVSRKR
FVVNIIEEAGFETDPATETGFWNRDLASSHLTSIAASQGVEVVRVHDIPLHKMAASLGQA
IFQAQEAADTNLKQYK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgattgataataaatggctgagtggccaagggacccttctttgtgggatcttaaatgtc
actccggattcattttctgatggcggtaagtatacgagtgtggatgcagccttgcagcag
gcgagaaaactgatccaagaaggagctcaactcctcgatatcggaggagaatcaaccaga
ccaggtagtcattatgtggagatccaagaagagattgaccgcgtggttccggtgattaaa
gccattcggaaagaaagtgatgtcttgatctcagtagatacctggaagtcacaggtggca
gccgcagcgcttgaagctggagctgatattgtcaacgatattacgggttttcttggagat
cctaagatggctgctgtggttgcggagcatgaagcgagcgcggttctcatgtttaatcca
gtgatggcaagaccgcatcatccaagttccactatctttccacgttttggttttgaacca
gtcttttcagagcaagagcttcaacagatggctcaagaaccgattcaagacttgatgtgg
accttctttaaccgctcgcttgcggtagcgaaagcagctggtgtccagacggatcgtatt
atgctggatcctgggatcggatttggtttgaccaagcgagagaacttactcttattacaa
gaacttgggacgattcaccaaaaggggtatccgatctttctaggggtctcccgcaaacgt
tttgtggtcaatattattgaggaagctggatttgagacagatcctgcaacggagactggt
ttttggaatcgggacctggcttcgagccatttgaccagtattgcagccagtcaaggagtc
gaagtagtgcgggtgcatgatattccccttcacaagatggcagccagtctgggccaagct
attttccaagcccaagaggcagcagataccaatttaaaacaatacaagtaa

DBGET integrated database retrieval system