KEGG   Streptococcus parasanguinis FW213: Spaf_0295Help
Entry
Spaf_0295         CDS       T02115                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:scf00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
310063..311013
Genome map
AA seq 316 aa AA seqDB search
MIDNKWLSGQGTLLCGILNVTPDSFSDGGKYTSVDAALQQARKLIQEGAQLLDIGGESTR
PGSHYVEIQEEIDRVVPVIKAIRKESDVLISVDTWKSQVAAAALEAGADIVNDITGFLGD
PKMAAVVAEHEASAVLMFNPVMARPHHPSSTIFPRFGFEPVFSEQELQQMAQEPIQDLMW
TFFNRSLAVAKAAGVQTDRIMLDPGIGFGLTKRENLLLLQELGTIHQKGYPIFLGVSRKR
FVVNIIEEAGFETDPATETGFWNRDLASSHLTSIAASQGVEVVRVHDIPLHKMAASLGQA
IFQAQEAADTNLKQYK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgattgataataaatggctgagtggccaagggacccttctttgtgggatcttaaatgtc
actccggattcattttctgatggcggtaagtatacgagtgtggatgcagccttgcagcag
gcgagaaaactgatccaagaaggagctcaactcctcgatatcggaggagaatcaaccaga
ccaggtagtcattatgtggagatccaagaagagattgaccgcgtggttccggtgattaaa
gccattcggaaagaaagtgatgtcttgatctcagtagatacctggaagtcacaggtggca
gccgcagcgcttgaagctggagctgatattgtcaacgatattacgggttttcttggagat
cctaagatggctgctgtggttgcggagcatgaagcgagcgcggttctcatgtttaatcca
gtgatggcaagaccgcatcatccaagttccactatctttccacgttttggttttgaacca
gtcttttcagagcaagagcttcaacagatggctcaagaaccgattcaagacttgatgtgg
accttctttaaccgctcgcttgcggtagcgaaagcagctggtgtccagacggatcgtatt
atgctggatcctgggatcggatttggtttgaccaagcgagagaacttactcttattacaa
gaacttgggacgattcaccaaaaggggtatccgatctttctaggggtctcccgcaaacgt
tttgtggtcaatattattgaggaagctggatttgagacagatcctgcaacggagactggt
ttttggaatcgggacctggcttcgagccatttgaccagtattgcagccagtcaaggagtc
gaagtagtgcgggtgcatgatattccccttcacaagatggcagccagtctgggccaagct
attttccaagcccaagaggcagcagataccaatttaaaacaatacaagtaa

DBGET integrated database retrieval system