KEGG   Streptococcus parasanguinis FW213: Spaf_0297Help
Entry
Spaf_0297         CDS       T02115                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Spaf_0297 (folE)
Enzymes [BR:scf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Spaf_0297 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
312333..312887
Genome map
AA seq 184 aa AA seqDB search
MDTKKIEEAVKMIIEAVGEDENREGLQETPSRIAKMYQEIFAGLGQTAEEHLSKSFEIID
NNMVVEKDIFFHSMCEHHFLPFYGKVHIAYIPNGRVAGLSKLARTVEVYAKKPQIQERLT
VEIADALMEYLGAQGALVWVEAEHMCMNMRGVRKPGTATVTTAARGLLATDKDLKNEAYK
LMGH
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggatacaaagaaaattgaagaagcagtgaaaatgatcatcgaggcagtcggtgaagat
gagaaccgtgaggggcttcaagaaactccgtcccgcattgcaaagatgtaccaagaaatc
tttgcgggactagggcagacagcggaagagcacctgtctaaatcatttgaaatcattgat
aacaatatggtggttgagaaggatattttcttccattccatgtgtgagcatcactttttg
ccgttttatggaaaagtgcacattgcctacattccaaatggccgtgttgctgggctttca
aaactggctcgtacggtcgaggtttatgctaaaaaaccacagattcaggaacgtttgacg
gtagaaatcgcagatgccttgatggaatatcttggagcacaaggagcacttgtctgggta
gaagcagagcatatgtgtatgaacatgcgtggtgtccgtaaacctgggaccgctacagtg
acaactgctgcgcgtggactgcttgcgacagataaagacttaaaaaatgaagcctataaa
ctcatgggccactaa

DBGET integrated database retrieval system