KEGG   Streptococcus parasanguinis FW213: Spaf_0298Help
Entry
Spaf_0298         CDS       T02115                                 

Gene name
folK
Definition
Folate synthesis protein
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:scf00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
312904..313722
Genome map
AA seq 272 aa AA seqDB search
MNRVDQLRIKDLEVYAYHGVFPAEKELGQRFVLDLWVDYEMTRAARTGDLEASIHYGILA
EQLTEWMQAEKIDLIETVAFQLVQKIFESYSFVEKVRLELKKPWAPVSLPLETCSVTIER
EKKRAFIGLGTNMGDKQLQLETALEKIRDRGIRLLQTSTRIETEPWGGVEQDTFLNQVAE
VETWMTPEDLLETLLAIEQEMGRVREVKWGPRVIDLDLLYMEDTICYSPSLILPHPYVAE
RAFVLESLNEIAPHFVDPVQRKPIRQLWDAVK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgaacagagtggatcaattacggatcaaggacttagaggtatacgcctatcacggtgtt
ttcccagcagaaaaagaattaggacaacgctttgtcctagacctatgggtagattatgag
atgactcgcgctgcccgcacaggtgatttggaagcttcgatccattatggaatcttggcg
gaacagttgaccgagtggatgcaggcagaaaagatcgatctgattgaaacggtggccttt
cagttggtgcaaaagattttcgaaagctattcctttgtagaaaaagttcgtctggagttg
aaaaaaccttgggctcctgtttccttgccattagagacttgttcggtgacaatcgaacgg
gagaaaaaacgggcctttattgggcttggcaccaatatgggagataaacaactgcaacta
gagacggcgctagaaaaaatcagggatcgaggcattcgccttcttcagacatccacaagg
attgaaacagaaccttggggaggagtggagcaagacacctttttgaatcaagtggcagag
gttgaaacctggatgaccccagaggatttactagagaccttacttgccatcgagcaggaa
atggggcgtgtccgtgaggtcaagtggggaccgcgtgtgattgatttagatctgctttat
atggaggacacgatttgttacagccctagcttgatcttgccgcacccttatgtggcagaa
cgagcctttgtattagaatctttaaatgaaattgctcctcattttgtggaccctgttcaa
agaaagcccattcgccaattatgggatgccgtcaaataa

DBGET integrated database retrieval system