KEGG   Streptococcus parasanguinis FW213: Spaf_0471Help
Entry
Spaf_0471         CDS       T02115                                 

Gene name
nagZ2
Definition
glycosyl hydrolase-like protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scf00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Spaf_0471 (nagZ2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Spaf_0471 (nagZ2)
Enzymes [BR:scf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Spaf_0471 (nagZ2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
488682..492221
Genome map
AA seq 1179 aa AA seqDB search
MKSHQPRYAIRKYAVGAASVLIGFFAGANVVAADTPTATDSPSTTVPTQPNESESTISLN
EEASQPAVEKPTAPAPIVDQSQPTLSDRELRVSDLDRLIREEASSVAESDVTTQPTTAAT
ETPAKDPDQEEKLAKKKIVSIDAGRKYFSPDQIKEIIDEASKTGYTDLHLLVGNDGLRFV
LDDMSLKVGDTSYSSQAVTDAVEKGTKAYYDDPNGTALTQAQMDDILAYAKSKKVGVIPT
INSPGHMDAILTAMEQLGIENPHFNYFGTKKSARTVDLDNQKAIDFTKALVDKYAAYFSG
KTDIFNIGLDEYANDATDAHGWQVLQASKHWPGEGYPEKGYEKFIQYANDLAAIVKKHKM
KPMAFNDGIYYNGDTSYGTFDKDIIVSYWTGGWNGYDVASSKLLSELGHQILNTNDAWYY
VLGRDKAGSGWYNLDQGLEGISKSAIDVVQKNDGSKVPFIGGMVAAWADAPSATYKKDLL
FKLMHAFADKNADYFVADLEVVGKALSEAPTDLDHYTPESLVAFTAAKKALEGVGADTTR
AEAKTLIDHLKAAQDALVYTESYAKEVAAKEAAEKLAMKKVISIDAGRKYFSLDQLKRIV
DKASELGYSDLHLLVGNDGMRFVLDDMTVEANGKTYASDDVKKAILEGTKAYYDDPNGQA
LTQAEMDELHAYATAKGIGLIAAVNSPGHMDALLVAMEKLGIENPQASFDTVSKTTMDLT
NEAAVNFTKALIGKYMDYFKDKSKIFNYGTDEYANDATSAQGWYYLKWYDLYGKFAEYSN
SLAAMAREKGLQPMAFNDGFYYGDEDDVAFDKDVLISYWSKGWWGYNLASPQYLADKGYK
FLNTNGDWYYVLGRTPETGGGYIEKAIANAAATPFRQLPSTTYPETSLPMIGSMVAVWCD
TPSEEYIEKNVFDLMEAFANHNKDYFKADFTALRKAVATVPTDLDIYTPESRAALAKVLD
SLNWNVSRAHQDQVDQEVATLTQALAGLKPITQVGSLAENDVKALVEDKPSLEIVEKELD
FDLVERSNPDLAKGERKVIQAGVKGQGLEYVEVSALDQSRKVIATEVATEPVAEIVEVGT
KEVVIPTTPSVEAPVKSDVLVNKVVPDPSTPQVISKDQPVAPGNTPTPIPAAVEKEVRSE
TVSSNKQLPETGAESALGLALLGAILGAAGMDLKNKKRD
NT seq 3540 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcacatcaaccacgttatgccattcgcaagtatgcagtaggagctgcttcggtg
ctcataggattttttgctggcgcgaatgttgtagcagctgatacgccaacggctacagac
agcccttcaacgacagttccaactcagccaaacgagagtgagtcaactatttcccttaat
gaggaagcttctcagccagcagtagaaaaaccaacggctcctgccccaatcgtcgatcaa
agtcaaccgacactgtctgatcgtgaattgcgggtatcagatcttgaccgtttgattcgc
gaagaagcaagttctgtcgcagagtcggatgtgacaactcaaccaacgacagcagcgacg
gaaacgcctgctaaagatcctgaccaagaagaaaaattagccaagaaaaagattgtttcg
attgatgccggtcgaaagtacttctcaccagaccaaatcaaggaaatcattgatgaagca
agtaagacgggctatacagacttgcatcttctagttggaaatgacggcttgcgctttgtg
ctggatgatatgtctttgaaagtgggagatacttcttattctagccaagccgtgacggat
gcggttgaaaaaggaacgaaagcttattacgatgatccgaacgggacagctttgacccag
gctcaaatggatgatattttggcctacgccaaatcgaagaaagtaggtgtcattccaacc
attaatagtccaggtcacatggatgcgattctgacagccatggaacaattgggcatcgaa
aaccctcactttaattattttggtacaaagaaatcagctcggacagttgatttggacaac
caaaaagccatcgacttcaccaaagccctggtagacaaatatgcagcttatttcagtggc
aagacagacattttcaatatcggtttggatgaatatgccaacgatgccacagatgcccat
ggttggcaggttctccaagccagcaagcattggccaggtgaaggctatccagaaaaaggc
tatgaaaaattcatccaatatgctaatgatctagcagctattgtgaaaaaacacaagatg
aaaccaatggcctttaatgacgggatctactacaatggcgatacttcctatggtactttt
gacaaggatatcattgtctcctactggacaggtggctggaacggctatgatgtcgcttct
tcaaaactcttgtctgaactaggtcatcagattcttaataccaatgatgcttggtattat
gtgcttggacgggacaaggctggatctggttggtacaaccttgatcaaggtctcgaagga
atttccaagtcagcgattgatgtcgttcaaaaaaatgatgggtctaaggtgcccttcatc
ggtgggatggtagctgcctgggcagatgcaccatccgcaacctacaaaaaagaccttctc
tttaagttgatgcatgccttcgcggacaagaatgcggactactttgttgcagatcttgaa
gtcgtcggaaaagctctttcagaagctccaactgatttggatcactatacaccggaatct
ctagtagcctttacggcagccaaaaaagctttagaaggggtaggagcagacacgactcga
gcagaggccaaaaccttgatcgatcatcttaaagcggctcaagatgctttggtgtataca
gaaagctacgcgaaagaagttgctgcaaaagaagcagcagaaaaactcgccatgaagaag
gtcatctcgatcgatgcaggtcgcaaatacttctcgctggatcagttgaaacggatcgta
gataaggccagtgagctgggttattctgacttgcacctccttgtcggaaacgatggtatg
cgcttcgtcctcgatgatatgacggtggaagccaatggcaaaacctatgccagtgacgat
gtgaaaaaggccattctagaaggcaccaaggcctattacgatgatccaaatggtcaagct
ttgacccaagcagaaatggatgaactccatgcttatgctactgctaaaggaatcggcttg
attgcggcagtcaatagtcctggacacatggatgctttgttggttgccatggaaaaattg
ggcattgaaaacccacaagccagctttgatacggtttcaaaaacaaccatggatttgacc
aatgaagcagcagtcaactttaccaaagccttgattggcaagtacatggactacttcaaa
gacaagtctaagatctttaactatggaacagatgaatatgccaatgacgctaccagtgca
caaggttggtactacctcaagtggtatgacctctatggtaaatttgcggagtattccaat
agtcttgcagccatggcgcgtgaaaaaggcttgcagccaatggcctttaacgatggcttc
tattatggagatgaagatgatgttgcctttgacaaggacgtcttgatttcatactggtct
aaaggatggtggggctataacctcgcatctccacagtatttggcagataagggttataaa
ttccttaataccaacggagactggtactatgttttgggaagaacacctgaaacgggtggt
ggttatattgagaaagcgattgccaatgcagctgctactccatttagacaactcccaagt
acaacgtatcctgaaacatctttgccgatgatcggtagcatggtagctgtttggtgtgat
accccaagtgaagaatacatcgaaaaaaatgtctttgatctcatggaagcttttgccaac
cataacaaggactatttcaaggcggacttcactgctcttagaaaagcagttgctacggtg
ccaacagatctagacatttacacaccagaatcgcgcgcagcccttgcgaaagtcttagat
agcttgaattggaatgtgagccgtgctcatcaagatcaggtggatcaagaagtggccact
ctgactcaagcccttgcggggctcaagccaatcacgcaagtaggtagcttggctgaaaat
gacgtcaaagccctagtggaagacaaaccaagtcttgaaatcgtagaaaaagaacttgat
tttgaccttgtggaacggagcaatccagatctcgctaaaggagaacgaaaagtgatccag
gctggggttaaagggcaaggtcttgagtatgtagaggtttcggcacttgatcaaagtcga
aaagtgattgctacagaagttgccacagagccggttgcagaaattgttgaagtcggtacc
aaagaagtcgtgatcccaacaaccccttccgtagaagcgccagtgaagtcagacgtgctc
gtaaacaaagtggttccagatccttcaacacctcaagtgatctcgaaagatcaaccagtt
gcaccaggaaataccccaacgccaattccagcagctgtggaaaaagaggttcgttcagaa
acagtatcttctaacaagcaacttccagaaacaggagcagaatctgctttgggactcgct
ttactaggagcgatcttaggggcagcaggaatggacttgaaaaataaaaaaagagactaa

DBGET integrated database retrieval system