KEGG   Streptococcus parasanguinis FW213: Spaf_0617Help
Entry
Spaf_0617         CDS       T02115                                 

Gene name
pgaM3
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
scf00010  Glycolysis / Gluconeogenesis
scf00260  Glycine, serine and threonine metabolism
scf00680  Methane metabolism
scf01100  Metabolic pathways
scf01110  Biosynthesis of secondary metabolites
scf01120  Microbial metabolism in diverse environments
scf01130  Biosynthesis of antibiotics
scf01200  Carbon metabolism
scf01230  Biosynthesis of amino acids
Module
scf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
scf_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:scf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spaf_0617 (pgaM3)
  Energy metabolism
   00680 Methane metabolism
    Spaf_0617 (pgaM3)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spaf_0617 (pgaM3)
Enzymes [BR:scf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Spaf_0617 (pgaM3)
Membrane trafficking [BR:scf04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Spaf_0617 (pgaM3)
Exosome [BR:scf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Spaf_0617 (pgaM3)
  Exosomal proteins of melanoma cells
   Spaf_0617 (pgaM3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFJ25625
UniProt: I1ZKQ1
Position
633265..633957
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDQAYTSVLKR
AIKTTNLALEASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPAMDRDDEHSAHTDRRYASLDDSVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKQLSDDEIMDVEIPNFPPLVFEFDEKLNVVKEYYLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggtttttgctcgccacggtgagtctgaatggaacaaagctaaccttttc
actggttgggctgatgttgatttgtctgaaaaaggtacacaacaagcgatcgacgctggt
aaattgatcaaagaagctggtatcgaatttgaccaagcttacacttcagtattgaaacgt
gcgatcaaaactactaacttggctcttgaagcttctgaccaattgtgggttccagttgaa
aaatcatggcgtttgaacgaacgtcactacggtggtttgactggtaaaaataaagcagaa
gctgctgaacaatttggtgatgaacaagttcacatctggcgtcgttcttacgatgtattg
cctcctgcaatggaccgtgatgatgaacactcagcacacactgaccgtcgttacgcttca
cttgacgattcagtgattccagatgctgaaaacttgaaagtgactttggaacgtgccctt
ccattctgggaagataaaatcgctccagctcttaaagacggtaaaaacgtattcgtagga
gcacacggtaactcaatccgtgcccttgttaaacacatcaaacaattgtcagacgacgaa
atcatggatgtggaaatccctaacttcccaccattggtattcgaatttgacgaaaaattg
aacgttgtaaaagaatactatcttggaaaataa

DBGET integrated database retrieval system