KEGG   Streptococcus parasanguinis FW213: Spaf_0617Help
Entry
Spaf_0617         CDS       T02115                                 

Gene name
pgaM3
Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:scf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spaf_0617 (pgaM3)
   01230 Biosynthesis of amino acids
    Spaf_0617 (pgaM3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spaf_0617 (pgaM3)
  Energy metabolism
   00680 Methane metabolism
    Spaf_0617 (pgaM3)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spaf_0617 (pgaM3)
Enzymes [BR:scf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Spaf_0617 (pgaM3)
Exosome [BR:scf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Spaf_0617 (pgaM3)
  Exosomal proteins of melanoma cells
   Spaf_0617 (pgaM3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
633265..633957
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDQAYTSVLKR
AIKTTNLALEASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPAMDRDDEHSAHTDRRYASLDDSVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKQLSDDEIMDVEIPNFPPLVFEFDEKLNVVKEYYLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggtttttgctcgccacggtgagtctgaatggaacaaagctaaccttttc
actggttgggctgatgttgatttgtctgaaaaaggtacacaacaagcgatcgacgctggt
aaattgatcaaagaagctggtatcgaatttgaccaagcttacacttcagtattgaaacgt
gcgatcaaaactactaacttggctcttgaagcttctgaccaattgtgggttccagttgaa
aaatcatggcgtttgaacgaacgtcactacggtggtttgactggtaaaaataaagcagaa
gctgctgaacaatttggtgatgaacaagttcacatctggcgtcgttcttacgatgtattg
cctcctgcaatggaccgtgatgatgaacactcagcacacactgaccgtcgttacgcttca
cttgacgattcagtgattccagatgctgaaaacttgaaagtgactttggaacgtgccctt
ccattctgggaagataaaatcgctccagctcttaaagacggtaaaaacgtattcgtagga
gcacacggtaactcaatccgtgcccttgttaaacacatcaaacaattgtcagacgacgaa
atcatggatgtggaaatccctaacttcccaccattggtattcgaatttgacgaaaaattg
aacgttgtaaaagaatactatcttggaaaataa

DBGET integrated database retrieval system