KEGG   Streptococcus parasanguinis FW213: Spaf_0685Help
Entry
Spaf_0685         CDS       T02115                                 

Gene name
recR
Definition
Recombinational DNA repair protein
Orthology
K06187  
recombination protein RecR
Organism
scf  Streptococcus parasanguinis FW213
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:scf03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
700378..700974
Genome map
AA seq 198 aa AA seqDB search
MLYPAPIAKLIDSYSKLPGIGIKTATRLAFYTIGMSDDDVNEFAKNLLNAKRELGYCSIC
GNLTDEETCEICRDETRDPSLILVVEDSRDVSAMENIQEYHGRYHVLHGLISPMNGVGPD
DINLKSLISRLMDGTVTEVIVATNATADGEATSMYISRVLKPAGIKVTRLARGLAVGADI
EYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgctttatccagcacctattgcaaaattaattgacagctattcgaagttgccaggaatt
gggatcaaaacagcgactcgtctggctttttacacgattggtatgtcggatgatgatgtc
aatgaatttgccaagaacttactgaatgccaagcgtgagctggggtattgcagtatttgt
ggaaatttaaccgatgaagaaacctgcgagatttgtcgagatgaaacgcgggatccatcc
ctcattctggttgtagaagatagccgggatgtatctgctatggagaatattcaggaatac
cacggtcgttaccatgtcttgcatggcttaatctcgcccatgaatggcgtgggacccgat
gatatcaatctcaagagtttgattagtcgcttgatggatggaacagtcacagaggtcatt
gttgcgaccaatgcgacggcagacggggaagcgacatcgatgtatatctcgcgcgtgctc
aagccagcagggatcaaagtgacacgtttggcacggggactcgcagttggagccgatatc
gagtatgcggacgaagtgaccttgcttcgcgcgattgaaaatcggacagaattataa

DBGET integrated database retrieval system