KEGG   Streptococcus parasanguinis FW213: Spaf_0782Help
Entry
Spaf_0782         CDS       T02115                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
scf00010  Glycolysis / Gluconeogenesis
scf00030  Pentose phosphate pathway
scf00051  Fructose and mannose metabolism
scf00052  Galactose metabolism
scf00680  Methane metabolism
scf01100  Metabolic pathways
scf01110  Biosynthesis of secondary metabolites
scf01120  Microbial metabolism in diverse environments
scf01130  Biosynthesis of antibiotics
scf01200  Carbon metabolism
scf01230  Biosynthesis of amino acids
scf03018  RNA degradation
Module
scf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:scf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spaf_0782
   00030 Pentose phosphate pathway
    Spaf_0782
   00051 Fructose and mannose metabolism
    Spaf_0782
   00052 Galactose metabolism
    Spaf_0782
  Energy metabolism
   00680 Methane metabolism
    Spaf_0782
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Spaf_0782
Enzymes [BR:scf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Spaf_0782
Protein phosphatases and associated proteins [BR:scf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Spaf_0782
Messenger RNA biogenesis [BR:scf03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Spaf_0782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1 DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AFJ25785
UniProt: I1ZL61
Position
805476..806534
Genome map
AA seq 352 aa AA seqDB search
MCYNYVECKRKKGANNEMKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAG
MVAGKIQPLDASSVGDIISRGGTFLHSARYPEFAQREGQLKGIEQLKKHGIEGVVVIGGD
GSYHGAMRLTEHGFPAIGLPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRT
FVVEVMGRNAGDIALWAGIATGADEIIIPEEGFKMEDIVASIKAGYEHGKKHNIIVLAEG
VMSAAEFGQKLKEAGDTSDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKLLKQGIGGV
AVGIRNEKMVENPILGTAEEGALFSLTADGKIVVNNPHKADLELSALNKSLS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
ttgtgttataattacgtagaatgtaaaagaaaaaaaggagcaaacaacgaaatgaaacgt
attgctgttttaactagtggtggagatgcccctgggatgaacgctgccatccgtgcagtt
gttcgtcaagcaatttcagaaggaatggaagttttcggtatctatgatggatacgcggga
atggttgctggtaaaatccagcctcttgatgcctcatctgttggagatattatttcccgc
ggtggtaccttccttcactcagcacgttaccctgaattcgcacaacgcgaaggtcaactt
aaagggattgagcagttgaaaaaacacggtatcgaaggtgtcgtggttatcggtggtgac
ggttcttatcacggagctatgcgcttgactgagcatggattccctgctatcggacttcca
ggaacaatcgataacgatatcgtaggtactgatttcacaatcggatttgatactgcagtt
acaactgcaatggatgccatcgataagattcgtgatacctcatcaagtcaccgtcgtact
ttcgtagttgaagttatgggacgtaatgctggagatatcgctctttgggctggtattgcc
actggtgctgatgaaattatcatccctgaagaaggcttcaagatggaagacatcgtagca
agtatcaaagctggatatgaacacggtaagaaacacaacattatcgttttggcagaaggt
gttatgtcagcggctgaatttggtcaaaagctaaaagaagctggagatacaagcgacctt
cgtgtaactgaacttggtcatatccaacgtggtggatctccaactgctcgtgaccgtgta
ttggcgtcacgcatgggtgcacatgctgttaaacttcttaaacaaggaatcggtggtgtc
gctgttggtattcgcaatgagaaaatggttgaaaatccaattcttggaactgcagaagaa
ggagctttgtttagcctaacagctgatggtaagattgttgttaacaaccctcataaagct
gaccttgaactttctgctttgaacaagagcttgtcataa

DBGET integrated database retrieval system