KEGG   Streptococcus parasanguinis FW213: Spaf_0782Help
Entry
Spaf_0782         CDS       T02115                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:scf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spaf_0782
   01230 Biosynthesis of amino acids
    Spaf_0782
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spaf_0782
   00030 Pentose phosphate pathway
    Spaf_0782
   00051 Fructose and mannose metabolism
    Spaf_0782
   00052 Galactose metabolism
    Spaf_0782
  Energy metabolism
   00680 Methane metabolism
    Spaf_0782
Enzymes [BR:scf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Spaf_0782
Protein phosphatases and associated proteins [BR:scf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Spaf_0782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
805476..806534
Genome map
AA seq 352 aa AA seqDB search
MCYNYVECKRKKGANNEMKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAG
MVAGKIQPLDASSVGDIISRGGTFLHSARYPEFAQREGQLKGIEQLKKHGIEGVVVIGGD
GSYHGAMRLTEHGFPAIGLPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRT
FVVEVMGRNAGDIALWAGIATGADEIIIPEEGFKMEDIVASIKAGYEHGKKHNIIVLAEG
VMSAAEFGQKLKEAGDTSDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKLLKQGIGGV
AVGIRNEKMVENPILGTAEEGALFSLTADGKIVVNNPHKADLELSALNKSLS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
ttgtgttataattacgtagaatgtaaaagaaaaaaaggagcaaacaacgaaatgaaacgt
attgctgttttaactagtggtggagatgcccctgggatgaacgctgccatccgtgcagtt
gttcgtcaagcaatttcagaaggaatggaagttttcggtatctatgatggatacgcggga
atggttgctggtaaaatccagcctcttgatgcctcatctgttggagatattatttcccgc
ggtggtaccttccttcactcagcacgttaccctgaattcgcacaacgcgaaggtcaactt
aaagggattgagcagttgaaaaaacacggtatcgaaggtgtcgtggttatcggtggtgac
ggttcttatcacggagctatgcgcttgactgagcatggattccctgctatcggacttcca
ggaacaatcgataacgatatcgtaggtactgatttcacaatcggatttgatactgcagtt
acaactgcaatggatgccatcgataagattcgtgatacctcatcaagtcaccgtcgtact
ttcgtagttgaagttatgggacgtaatgctggagatatcgctctttgggctggtattgcc
actggtgctgatgaaattatcatccctgaagaaggcttcaagatggaagacatcgtagca
agtatcaaagctggatatgaacacggtaagaaacacaacattatcgttttggcagaaggt
gttatgtcagcggctgaatttggtcaaaagctaaaagaagctggagatacaagcgacctt
cgtgtaactgaacttggtcatatccaacgtggtggatctccaactgctcgtgaccgtgta
ttggcgtcacgcatgggtgcacatgctgttaaacttcttaaacaaggaatcggtggtgtc
gctgttggtattcgcaatgagaaaatggttgaaaatccaattcttggaactgcagaagaa
ggagctttgtttagcctaacagctgatggtaagattgttgttaacaaccctcataaagct
gaccttgaactttctgctttgaacaagagcttgtcataa

DBGET integrated database retrieval system