KEGG   Streptococcus parasanguinis FW213: Spaf_0914Help
Entry
Spaf_0914         CDS       T02115                                 

Gene name
glpK
Definition
Glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:scf00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
935073..936581
Genome map
AA seq 502 aa AA seqDB search
MSQETFIMAIDQGTTSSRAIIFNKKGEQVSSSQKEFTQIFPQAGWVEHNANEIWNSVQSV
IAEVFIESGIKPNQIEAIGITNQRETTVVWDKNTGLPIYNAIVWQSRQTAPLAEELKNQG
YVETFHQKTGLVIDAYFSATKVRWILDHVEGAQERAEKGELLFGTIDTWLVWKLTDGAAH
VTDYSNAARTMLYNIKELKWDEEILEILNIPKAMLPEVRSNSEIYGKTAPFHFYGGQVPI
AGMAGDQQAALFGQLAFEPGMVKNTYGTGSFIIMNTGEEMQLSENNLLTTIGYGINGKVY
YALEGSIFIAGSAIQWLRDGLRMINSSPESEAYALKSQNQDEIYVVPAFTGLGAPYWNQE
ARGSVFGLTRGTTKEDFIKATLQSIAYQVRDIIDTMQVDAKTPIPVLKVDGGAAKNDYLM
QFQADILGIAIARAKNLETTALGAAFLAGLTVGYWKDLEELKSLHGAAQIFEPKMNESRK
EELYKGWKKAVKATQVFAESDD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagaaactttcatcatggcgattgaccagggaaccactagttcgcgggctatc
atttttaataaaaaaggcgagcaagttagctctagtcaaaaggaattcactcagattttt
ccgcaggctggttgggtggaacacaatgccaatgagatttggaactcggttcagtcggtg
atcgctgaggtctttattgaaagtggcatcaagcccaatcaaatcgaggcgatcggcatt
accaatcaacgggaaacgacagttgtttgggataagaacacaggccttcctatttacaat
gctattgtctggcaatcgcgacaaactgctccactggctgaagaacttaaaaaccaaggc
tatgtagaaaccttccaccaaaagacaggtttggtcatcgatgcctacttttcagcaaca
aaagttcgttggattttggaccatgttgaaggagcacaagagcgtgcagaaaaaggagaa
ttgctctttgggaccattgatacttggttggtctggaagctgacggatggagcagcccac
gtgacagactattctaatgctgctcggaccatgctttacaatatcaaggaactaaaatgg
gacgaagaaattttggaaatcctcaacattcctaaagccatgcttcctgaagtccgttca
aactctgaaatttatggcaagacagcgcctttccatttctacggtggacaagtgccgatt
gcagggatggcgggagaccagcaagctgccctctttggtcaattagcctttgaacctggg
atggtcaagaatacttacggaactggatcttttatcatcatgaacacgggtgaagagatg
cagttatcagaaaataacttgctgacgacgattggatatgggatcaatggcaaggtctac
tacgcccttgaaggatcgatctttatcgccggaagtgctattcagtggcttcgtgacggt
ctgcggatgatcaacagttcacctgaatctgaggcctatgctttgaagtcccagaaccag
gatgaaatctatgtggtccctgcctttacgggtcttggagcaccatactggaatcaagag
gcgcgtggttctgtctttggacttacccggggaacgaccaaggaagactttatcaaggca
acccttcaatccattgcttatcaagtacgcgatattatcgacaccatgcaggtagatgcc
aagactcctatccctgtcctaaaagtagacggaggagcagcgaaaaatgattatttaatg
cagtttcaggcagatattcttggaattgcaattgcccgcgcgaaaaacttggaaacaacg
gctctaggagcagccttcctagcaggtctgaccgtaggctattggaaggacttggaagaa
ttaaaatctcttcatggagcagcccaaatctttgaacccaagatgaatgaatctcgaaag
gaagagctgtacaaggggtggaagaaagcagtcaaagccactcaagtatttgcagagtct
gatgactaa

DBGET integrated database retrieval system