KEGG   Streptococcus parasanguinis FW213: Spaf_0914Help
Entry
Spaf_0914         CDS       T02115                                 

Gene name
glpK
Definition
Glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scf00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Spaf_0914 (glpK)
Enzymes [BR:scf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Spaf_0914 (glpK)
Exosome [BR:scf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Spaf_0914 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
935073..936581
Genome map
AA seq 502 aa AA seqDB search
MSQETFIMAIDQGTTSSRAIIFNKKGEQVSSSQKEFTQIFPQAGWVEHNANEIWNSVQSV
IAEVFIESGIKPNQIEAIGITNQRETTVVWDKNTGLPIYNAIVWQSRQTAPLAEELKNQG
YVETFHQKTGLVIDAYFSATKVRWILDHVEGAQERAEKGELLFGTIDTWLVWKLTDGAAH
VTDYSNAARTMLYNIKELKWDEEILEILNIPKAMLPEVRSNSEIYGKTAPFHFYGGQVPI
AGMAGDQQAALFGQLAFEPGMVKNTYGTGSFIIMNTGEEMQLSENNLLTTIGYGINGKVY
YALEGSIFIAGSAIQWLRDGLRMINSSPESEAYALKSQNQDEIYVVPAFTGLGAPYWNQE
ARGSVFGLTRGTTKEDFIKATLQSIAYQVRDIIDTMQVDAKTPIPVLKVDGGAAKNDYLM
QFQADILGIAIARAKNLETTALGAAFLAGLTVGYWKDLEELKSLHGAAQIFEPKMNESRK
EELYKGWKKAVKATQVFAESDD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagaaactttcatcatggcgattgaccagggaaccactagttcgcgggctatc
atttttaataaaaaaggcgagcaagttagctctagtcaaaaggaattcactcagattttt
ccgcaggctggttgggtggaacacaatgccaatgagatttggaactcggttcagtcggtg
atcgctgaggtctttattgaaagtggcatcaagcccaatcaaatcgaggcgatcggcatt
accaatcaacgggaaacgacagttgtttgggataagaacacaggccttcctatttacaat
gctattgtctggcaatcgcgacaaactgctccactggctgaagaacttaaaaaccaaggc
tatgtagaaaccttccaccaaaagacaggtttggtcatcgatgcctacttttcagcaaca
aaagttcgttggattttggaccatgttgaaggagcacaagagcgtgcagaaaaaggagaa
ttgctctttgggaccattgatacttggttggtctggaagctgacggatggagcagcccac
gtgacagactattctaatgctgctcggaccatgctttacaatatcaaggaactaaaatgg
gacgaagaaattttggaaatcctcaacattcctaaagccatgcttcctgaagtccgttca
aactctgaaatttatggcaagacagcgcctttccatttctacggtggacaagtgccgatt
gcagggatggcgggagaccagcaagctgccctctttggtcaattagcctttgaacctggg
atggtcaagaatacttacggaactggatcttttatcatcatgaacacgggtgaagagatg
cagttatcagaaaataacttgctgacgacgattggatatgggatcaatggcaaggtctac
tacgcccttgaaggatcgatctttatcgccggaagtgctattcagtggcttcgtgacggt
ctgcggatgatcaacagttcacctgaatctgaggcctatgctttgaagtcccagaaccag
gatgaaatctatgtggtccctgcctttacgggtcttggagcaccatactggaatcaagag
gcgcgtggttctgtctttggacttacccggggaacgaccaaggaagactttatcaaggca
acccttcaatccattgcttatcaagtacgcgatattatcgacaccatgcaggtagatgcc
aagactcctatccctgtcctaaaagtagacggaggagcagcgaaaaatgattatttaatg
cagtttcaggcagatattcttggaattgcaattgcccgcgcgaaaaacttggaaacaacg
gctctaggagcagccttcctagcaggtctgaccgtaggctattggaaggacttggaagaa
ttaaaatctcttcatggagcagcccaaatctttgaacccaagatgaatgaatctcgaaag
gaagagctgtacaaggggtggaagaaagcagtcaaagccactcaagtatttgcagagtct
gatgactaa

DBGET integrated database retrieval system