KEGG   Streptococcus parasanguinis FW213: Spaf_1149Help
Entry
Spaf_1149         CDS       T02115                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
scf00010  Glycolysis / Gluconeogenesis
scf00052  Galactose metabolism
scf00500  Starch and sucrose metabolism
scf00520  Amino sugar and nucleotide sugar metabolism
scf00521  Streptomycin biosynthesis
scf01100  Metabolic pathways
scf01110  Biosynthesis of secondary metabolites
scf01120  Microbial metabolism in diverse environments
scf01130  Biosynthesis of antibiotics
scf01200  Carbon metabolism
Module
scf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
scf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:scf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spaf_1149
   00052 Galactose metabolism
    Spaf_1149
   00500 Starch and sucrose metabolism
    Spaf_1149
   00520 Amino sugar and nucleotide sugar metabolism
    Spaf_1149
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Spaf_1149
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Spaf_1149
Enzymes [BR:scf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Spaf_1149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase FGGY_N DUF460
Motif
Other DBs
NCBI-ProteinID: AFJ26136
UniProt: I1ZM62
Position
complement(1156004..1156963)
Genome map
AA seq 319 aa AA seqDB search
MSKKIIGIDLGGTSIKFAILTLDGEVQEKWSIKTNILDEGSHIVDDMIESIAHRLKMLGL
DASEFQGIGMGSPGVVDREKGTVIGAYNLNWKTLQPVKEKIESALHIPFFIDNDANVAAL
GERWKGAGENQPDVVFMTLGTGVGGGIVAEGRLLHGVRGAAGELGHITVDFDDPIQCTCG
KKGCLETVASATGIVNLTRRYADEYEGDSQLKVLIDNGEEVTAKTVFDLAKEGDALALIV
YKNFSRYLGLAAANIGSTLNPSKIVIGGGVSAAGEFLLEGVRKVFEENSFPQVRESTQLA
LATLGNDAGVIGAASLVLQ
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaaaattattgggattgaccttggaggaacttcgatcaaatttgccattctt
accttggatggagaggttcaagaaaaatggtctattaaaacaaatatcttggatgaaggt
agtcatattgtagatgatatgatcgaatcaatcgcgcatcgtttgaagatgcttgggctt
gatgcttctgagttccaaggaattggaatgggatcacctggtgtcgttgaccgtgaaaaa
ggtacagttatcggtgcctacaacttgaactggaagacccttcaaccagtcaaagaaaag
atcgaaagtgcccttcatattccattctttatcgataatgatgccaacgttgctgctttg
ggtgaacgttggaaaggagctggtgaaaaccaaccagatgttgttttcatgactcttgga
acaggtgtcggcgggggaatcgtcgctgaaggtcgcctcttacatggtgtgcgtggagct
gctggtgagcttggtcatatcactgttgattttgatgatccaattcaatgtacctgtggt
aaaaaaggatgtctcgaaacggttgcatctgcaactggtatcgtcaacttgactcgtcgt
tatgcggatgagtacgagggagattctcaattgaaagtcttgatcgacaatggtgaagaa
gtgaccgctaaaactgtctttgatctagcaaaagagggtgatgctcttgctttgatcgtt
tataagaacttctcacgttaccttgggcttgctgctgccaacattggttcaactttaaat
ccatctaagatcgttatcggtggtggagtttcggctgcaggtgaattcctattggaagga
gtgcgcaaagtctttgaagaaaactcattcccacaagtgcgtgaatcaacacaattggct
cttgctaccttgggaaatgatgccggtgtcattggtgcggcatcccttgttttacaatga

DBGET integrated database retrieval system