KEGG   Streptococcus parasanguinis FW213: Spaf_1247Help
Entry
Spaf_1247         CDS       T02115                                 

Gene name
proB
Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
scf00330  Arginine and proline metabolism
scf00332  Carbapenem biosynthesis
scf01100  Metabolic pathways
scf01130  Biosynthesis of antibiotics
scf01230  Biosynthesis of amino acids
Module
scf_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:scf00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Spaf_1247 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Spaf_1247 (proB)
Enzymes [BR:scf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Spaf_1247 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AFJ26231
UniProt: I1ZMF7
Position
complement(1249747..1250856)
Genome map
AA seq 369 aa AA seqDB search
MKAKRIVFKVGTSSLTNPDGSLSRQKVKVITQQLALLHESGHELILVSSGAVAAGFGALG
FKKRPTKVADKQASAAVGQGLLMEEYTANLLLRNIVSAQILLTQDDFADQRRYKNAHQAL
SVLLNRGAIPIINENDTVSIAELKVGDNDTLSAQVAAMVQADLLVLLTDVDGLYTANPSQ
DPTAKRLDRIEHISREMIEMAGGAGSSNGTGGMLTKLKAATLATESGVPVYICSSLKSDA
LIEAAQEQADGSYFLAEDKGLKTQKQWLAFYAESKGAVWVDAGAAEALLDHGKSLLISGV
TKAEGDFSYHDIVSVYHQESGQLLGKGKVRLGQSAVRDLLQSKKAKGILIHRDDWISVTP
EIDLLFTEF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaaaacgaatcgtctttaaagtagggacctcgtcgttgaccaatcccgatggg
agcctctccagacagaaggtcaaggtcattacgcagcagttggctctcttacatgaatca
ggtcatgagttgatcttggtctcatcaggggctgtcgctgctggatttggtgcccttggt
tttaagaaacggccgacaaaggtggcagacaagcaagcctctgcagcagttgggcaaggc
ttactgatggaagaatacacagctaacctgctcttgcgcaacattgtttctgcgcagatt
ttgttgacccaggatgactttgcggatcagcgccgctataagaatgcccatcaggccctt
tctgtcttgctcaatcgtggagccatcccgattatcaatgaaaacgatacggtctcgatt
gctgagttaaaagtaggagacaatgataccttaagtgcgcaggttgcagccatggttcaa
gcggatcttttggtgcttttaacagatgtagatggcctctatacagccaatccttctcag
gatccaacagctaagcgcttggatcgaatcgaacacatttctcgtgagatgatcgagatg
gctggtggtgctggcagtagcaacggaactggtggaatgctgaccaaactcaaggcagcg
acccttgcgaccgagtcaggggttccggtctatatttgctcgtctctcaagtctgatgcc
ttgattgaagcagcgcaagagcaagcagatggcagttacttccttgcagaggacaagggc
ttaaaaacacagaagcaatggctagccttttatgcagaaagcaaaggtgctgtttgggtg
gatgctggagcagcggaagccctgttggatcatggaaagagtctattgatttctggtgtg
accaaggcagaaggggatttctcttatcacgacatcgtcagcgtctatcatcaagaatca
ggacaattgcttgggaaagggaaagttcgtctcggtcaatcagccgtgcgtgatctactc
caatctaaaaaagccaagggaatccttatccaccgggatgattggatctcggtaactccc
gagattgacctactctttacagaattttag

DBGET integrated database retrieval system