KEGG   Streptococcus parasanguinis FW213: Spaf_1316Help
Entry
Spaf_1316         CDS       T02115                                 

Gene name
nagZ3
Definition
Beta-hexosamidase A
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scf00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Spaf_1316 (nagZ3)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Spaf_1316 (nagZ3)
Enzymes [BR:scf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Spaf_1316 (nagZ3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1322171..1324600)
Genome map
AA seq 809 aa AA seqDB search
MKKIIYPSAALLTAFALLSVQTAKADTAQASDQANEPVATVEEAVAFPTPETATENQGEV
AETPTTTDRAAVPAASPTVTSTETASPEVEKLIENMPLKQKVTQMIMPDFRKWQEANQES
PQDLTKVNAEVADAIDKYDFGGVILFAENVKETKQTLALTQDMQKAAIENKANNGKIPLL
LAIDQEGGIVYRLGTGTALPGNMAIGATNDPKLAKEAGQIIGRELSALGLNVDFAPVLDT
NNNPQNPVIGLRSFSSDPNRVAYLGIPMMKGIQDYNVAVAAKHFPGHGDTAVDSHTGLPL
VDKSLAELEKLELLPFKKAMDEGVDLLMTAHIQYPQIEKDQVVSKETGERIYVPATLSDD
ILTGLVRKKYGYKGVIVSDAMGMDAIAKNFGEVEAVKMAIKAGVDLVLMPTTLRSKADLT
KIDTIVNAVVDAVQTGDISEDRVNESVRRILTLKEKRGVLNFDPSARTAEKAEEAVGSTL
NRDLERKIAAAAVTVVKNEDNTLPFKVQTGDHVLLLGAFENEVPGLNLGMRRLIADGVLP
KDTSFVAKNFTKESTLDSLKEDLEKATHIVVISEIGYEGQLDKDFWRTKIPTEIVNYANT
THKKAAVLSISKPYDVANYPAAKAILAVYGNKGMDPTESLKPDNAFGPNIPAGVEVIFNG
KEHLGTLPVDIPKIVDGKMSETEYAYRIGHGLFYPAPAPLPTPAPLPTPETQDPTSPVLD
PPHQTQPVEIGHTGIQVLGSKQEKVTPLDGPQVTPISVSHDTAQAPASVSASPASSVLPK
TGQTGNLLSLMGVSLLTFLGSFVYPRKKH
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcatttatccatctgcagccctattaacggcttttgctctattatccgtt
caaacagcaaaagcagacacagctcaagcgtcggatcaagccaatgaaccggtagcaaca
gtagaagaggcggtggcttttccaacgccagaaaccgccacagaaaatcagggagaagtg
gccgaaacgccgacgacaacagaccgtgcagctgtccctgctgcctctccaacggtaaca
tcaacagagacagcatctcctgaagtggaaaaactgattgaaaacatgccactcaaacaa
aaagtgactcaaatgatcatgccggacttccgtaagtggcaggaggctaatcaggagtcg
ccacaggatctcaccaaggtcaatgctgaagtagcggatgcgattgataaatatgatttt
ggaggcgtcattctttttgctgaaaacgttaaagaaaccaagcaaacactggctctgacg
caagatatgcaaaaagcagcgattgaaaacaaggccaataatgggaagattccgctatta
ttagccatcgaccaagaaggggggatcgtctaccgcttgggtacgggtacagcccttcct
ggaaatatggctattggggctaccaatgatcccaaactagcgaaagaagccggtcaaatc
atcggacgtgaactttctgcactaggcttgaatgtggacttcgctccggttctagatacc
aataacaatcctcaaaaccctgtgattgggcttcgttccttctcatctgatccaaaccga
gttgcttacttgggtattccgatgatgaaaggcattcaggactacaatgtggctgtagca
gccaagcatttcccaggtcacggagatacagcggtcgattcacatacgggtctgccattg
gtggataaatctcttgctgagcttgaaaaattggaactccttccattcaaaaaagctatg
gatgaaggggtagacctcttgatgacggctcatatccaatacccgcagattgaaaaagat
caggtcgtttcaaaagaaacaggtgagagaatctatgttccagcgactctctctgatgat
attttaacgggtttggtacggaagaaatatggctataagggagtgattgtctccgatgcc
atgggaatggatgctatagctaagaacttcggtgaggtggaagccgtgaagatggccatc
aaagcaggagttgatttggtcttgatgccaacgacccttcgcagcaaagccgatttgacc
aagattgataccattgtcaatgcagtggtagatgcggtccaaaccggtgacatttcagaa
gatcgcgtaaatgagtcggttcgccggatcctgaccctcaaagaaaaacgtggggtcctg
aattttgatccaagtgctcgaacagctgaaaaagcagaggaagcagttggatctaccctc
aatcgtgacttggaacgcaagattgcagcggcagcggtgacggttgtaaaaaatgaagac
aataccttgccatttaaggtgcaaacaggggaccatgtcttactcttaggagcttttgaa
aacgaagttcctggactaaatttgggtatgcgtcgcttaattgcggacggagtgcttcca
aaagatacctcctttgtggccaagaacttcactaaagaatctacccttgatagtctaaaa
gaagacctcgaaaaagcaactcacatcgtagtgatttcagagatcggttatgaagggcaa
ctggataaagatttctggcggaccaagatcccaacagaaatcgtcaattatgccaatacc
acccataagaaggcagctgtcctttctatctctaaaccttatgatgtagccaactatcca
gcagccaaagccattctagcagtctatggaaataagggaatggatccaacggaatccctc
aaaccagacaatgcatttggtcctaatattcctgcaggagtggaagtcatcttcaatggc
aaggaacatctaggtaccttgccggttgatattccaaaaattgtagacggaaaaatgtcg
gaaacagagtacgcctaccgcattggtcatggtctcttctatccagcacctgctccattg
ccaacacctgctccactgccaacaccagaaacccaagatccaacttcaccagttttagat
ccaccccatcagacacaaccagtagagattggtcatactggaatacaggttcttggtagc
aagcaagaaaaagtgacccctcttgatggaccacaagttactccgatttctgtatcacat
gacactgctcaggctcctgcaagtgtatctgctagtcctgcctcatcggtattgccaaag
actggtcaaacagggaacctcctatcccttatgggtgtcagcctcttaaccttccttgga
tcttttgtctatccaagaaagaaacactaa

DBGET integrated database retrieval system