KEGG   Streptococcus parasanguinis FW213: Spaf_1317Help
Entry
Spaf_1317         CDS       T02115                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:scf00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1324726..1326222)
Genome map
AA seq 498 aa AA seqDB search
MKARSSKTWLSKKEKETIMPIQNKTMLITYSDSLGNNLKDLYENLEKHFGDAVGGVHLLP
FFPSTGDRGFAPVDYDQVDPAFGDWEDVKRLGDKYYLMFDFMINHISRQSKYYKDYQEKH
DQSAYKDLFLNWDKFWPENRPTQADVDLIYKRKDRAPKQEITFADGTTEHLWNTFGEEQI
DLDVTKEVTMDFIRKTIEHLASNGCDLIRLDAFAYAVKKLDTNDFFVEPDIWDLLDKMRD
MAAGYGAELLPEIHEHYSIQFKIADHDYYVYDFALPMVTLYSLYSSKVDRLAKWLKMSPM
KQFTTLDTHDGIGVVDVKDILTDEEIDYASNELYKVGANVKRKYSTAEYNNLDIYQINST
YYSALGDDDRKYFLARLIQAFAPGIPQVYYVGFLAGKNDLELLENTKEGRNINRHYYSNE
EIAQEVERPVVQSLLKLFSFRNNSQAFDLEGSIEVETPDDHTIVITRQNKDQSVTAVARI
DLADGTYQVTENGQEMVF
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccaggtcctcaaagacttggctttcaaaaaaagaaaaggaaaccattatgcca
attcaaaacaaaactatgttaattacttactcagatagcttaggaaataacctcaaggat
ctctatgaaaatctggagaagcactttggggatgcagtaggtggagttcacctcttgcca
tttttcccatcaactggtgaccgtggctttgcgcctgtagactatgaccaagtggatcca
gcctttggagattgggaagatgtcaaacgcttgggcgacaagtactatcttatgtttgac
tttatgatcaatcacatttctcgtcagtctaaatactacaaggactaccaagaaaagcac
gaccaaagtgcctacaaggacctctttctcaactgggacaagttctggccggagaatcgt
ccgactcaagcagatgtagatttgatttataagcgcaaagaccgagctcccaagcaagaa
atcacttttgcggatgggacgactgagcatctctggaatactttcggggaagagcagatt
gacctagacgtgaccaaggaagtgaccatggactttattcgcaagaccatcgaacacctg
gcaagcaatggctgtgacctcattcgtctagatgcctttgcctatgcggtcaagaaattg
gataccaatgatttcttcgtggagccagacatttgggatttgttggataagatgcgcgat
atggcagcaggctacggtgctgagcttcttccagagattcatgagcactattccatccaa
tttaagattgccgatcacgactattatgtctatgattttgcgcttccaatggtcaccctc
tatagcctctatagctcaaaagtggatcgccttgccaagtggttgaagatgagtcccatg
aagcagttcacgacgctcgatacccatgatggaattggggtggtcgatgtcaaggacatt
ttgacagatgaagagattgactatgcttcaaatgagctctataaggtaggagcaaatgtt
aaacgcaaatattccacagcagaatacaacaacttggacatctaccaaatcaattcaacc
tattattcagcgcttggagatgacgatcgtaagtacttcctagcccgtttaattcaagct
tttgcgccaggcattccacaagtttattacgttggattcctagctgggaagaatgatttg
gaactcttagaaaacaccaaagaaggccgcaatatcaaccgtcattactacagcaatgaa
gaaatcgctcaagaagtagagcgaccagtcgtgcaatcccttctcaaactctttagtttc
cggaacaactcgcaagcttttgacctagaaggaagcattgaagtggaaacaccagatgat
catacgattgtcatcacgcgccaaaataaagaccagtccgtcacagcagtagctcgaatc
gatcttgctgatggcacttaccaagtgacagaaaatggtcaagaaatggtgttttaa

DBGET integrated database retrieval system