KEGG   Streptococcus parasanguinis FW213: Spaf_1351Help
Entry
Spaf_1351         CDS       T02115                                 

Gene name
cps19fO
Definition
dTDP-4-keto-L-rhamnose reductase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:scf00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:scf00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1363499..1364092)
Genome map
AA seq 197 aa AA seqDB search
MTEQFFEKELAARKIDAIPGLMEFDIPVRGDNRGWFKENFQKEKMLPLGFPESFFAEGKL
QNNISFSRKNVLRGLHAEPWDKYISVADEGKVLGTWVDLREGDSFGNTYQTVIDASKGIF
VPRGVANGFQVLTDKVAYTYLVNDYWALELKPKYAFVNYADPSLDIQWENLQEAEVSEAD
KNHPLLKDVKPLKAEDL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacaatttttcgaaaaagaattagcagcccgcaaaattgatgctatcccaggc
ttgatggagtttgatattccagtgcgtggggataaccgtggttggtttaaagaaaacttc
caaaaagagaaaatgcttccccttggtttccctgaaagcttctttgcagaaggtaagttg
caaaacaatatttcattctctcgtaagaatgttttgcgtggcttgcatgcagagccttgg
gacaagtacatctctgtagctgatgaaggtaaggttcttggaacttgggtagaccttcgt
gaaggcgatagctttgggaacacctaccaaaccgtgatcgatgcttcaaaaggcatcttt
gttcctcgtggtgttgccaatgggttccaagttttgacagacaaagttgcctatacatac
ttagtcaatgattactgggcattggaactcaaaccaaaatatgcttttgtcaactatgca
gatccaagcctagatatccaatgggaaaacttgcaagaagcagaagtctcagaagcagac
aagaatcacccactgcttaaagatgtcaaacccctaaaagcagaagatttgtaa

DBGET integrated database retrieval system