KEGG   Streptococcus parasanguinis FW213: Spaf_1379Help
Entry
Spaf_1379         CDS       T02115                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
scf00480  Glutathione metabolism
scf00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:scf00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Spaf_1379
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Spaf_1379
Enzymes [BR:scf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Spaf_1379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AFJ26355
UniProt: I1ZMT1
Position
1391367..1391849
Genome map
AA seq 160 aa AA seqDB search
MTSIYDFSLENQNGEEIPLSHYQGKVLIVVNTATGCGLTPQYQGLQDLYLRYQEKGLEIL
DIPCNQFMGQAPGTAEEINSFCSLNYQTTFPRFAKAKVNGKEALPLYDWLKSQAAGPLGK
RIEWNFAKFVIDRQGQVAQRFSSKTEPAAMEDLIQELLEK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcatttatgatttttctttagaaaaccagaatggggaggagattcccctttct
cactaccaaggtaaggtcctcattgtggtcaatacagcaacagggtgtggcttgaccccg
caataccaaggactgcaagatctctacctgcgctaccaggaaaaggggctggaaatccta
gacattccctgtaaccaattcatggggcaggcaccaggaactgcagaagaaatcaatagc
ttctgcagcctcaactatcagaccaccttcccacgattcgctaaagccaaggtcaatggt
aaagaagcccttcctctctatgactggcttaaaagccaagcagctgggccactgggcaaa
cgcatcgaatggaacttcgcaaaatttgtcatcgaccgacaaggccaagtcgcccaacgc
ttctcctccaaaacagaaccagctgctatggaagacttgatccaagaattacttgagaaa
taa

DBGET integrated database retrieval system