KEGG   Streptococcus parasanguinis FW213: Spaf_1438Help
Entry
Spaf_1438         CDS       T02115                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
scf00010  Glycolysis / Gluconeogenesis
scf00051  Fructose and mannose metabolism
scf00562  Inositol phosphate metabolism
scf01100  Metabolic pathways
scf01110  Biosynthesis of secondary metabolites
scf01120  Microbial metabolism in diverse environments
scf01130  Biosynthesis of antibiotics
scf01200  Carbon metabolism
scf01230  Biosynthesis of amino acids
Module
scf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
scf_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:scf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spaf_1438 (tpiA)
   00051 Fructose and mannose metabolism
    Spaf_1438 (tpiA)
   00562 Inositol phosphate metabolism
    Spaf_1438 (tpiA)
Enzymes [BR:scf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Spaf_1438 (tpiA)
Exosome [BR:scf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Spaf_1438 (tpiA)
  Exosomal proteins of bladder cancer cells
   Spaf_1438 (tpiA)
  Exosomal proteins of melanoma cells
   Spaf_1438 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFJ26411
UniProt: I1ZMY7
Position
complement(1453110..1453868)
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSADLVEAGIAAPAVDLTTVLAAAKGSNL
KVAAQNTYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFAN
GMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVASTVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDVVAADFGQEVADKVRVQYGGSVKPENVAEYMACPDVDGALVGGASLD
PESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagca
aaagcatttgttgaagctgtagcatcaaaacttccttcagctgatcttgttgaagctgga
atcgcggctcctgcagttgacttgactacagtacttgctgctgctaaaggttcaaacctt
aaagttgctgcccaaaacacttactttgaaaatgctggtgccttcactggtgaaactagc
ccacaagttttgaaagaaatcggtactgactacgttgttatcggtcactcagaacgtcgt
gactacttccacgaaactgatgaagatatcaacaaaaaagcaaaagcaatttttgcgaac
ggtatgcttccaatcatctgttgtggtgaaagccttgaaacttacgaagctggtaaagca
gcagaattcgtaggtgctcaagtttcagctgctcttgctggattgactgcagaacaagtc
gcttcaacagttattgcatacgaaccaatctgggcgatcggtactggtaaatcagcttca
caagacgacgcacaaaaaatgtgtaaagttgttcgtgacgttgtagctgctgactttggt
caagaagtggctgataaagttcgtgttcaatacggtggttcagttaaacctgagaacgtt
gctgaatacatggcttgtccagacgttgacggagctcttgtaggtggtgcatcacttgat
ccagaaagcttcttggcattgcttgacttcgttaaataa

DBGET integrated database retrieval system