KEGG   Streptococcus parasanguinis FW213: Spaf_1777Help
Entry
Spaf_1777         CDS       T02115                                 

Definition
beta-hexosamidase a, glycoside hydrolase family 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:scf00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:scf00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1791984..1793678
Genome map
AA seq 564 aa AA seqDB search
MLNLTQKPYLLTTKQAESIQQLVSEMTTEEKIGQLFFVIGQDEERVSLDDFIDTYKPGGL
MFRPGPAAQISRQIKQIQHHSKFPLFFAANLESGGNGIISEGTWLGNPLQMAATNDPQAA
FELGNIAGYEANQVGCNMSFSPIVDIDLNFKNPITNTRTFGSDPDRVLRMAKAQIQGLEA
NGITPVIKHFPGDGVDERDQHLLSSINSLSAEDWSSSYGQIYKSLIDQGTPCVMIGHIYQ
PAWERKLSPEIKDQDLRPASASKLLIDGLLRTELGFNGLAITDATAMVGYNVILPRKELL
PATINAGIDMILFNKNIDEDYAIMTEAVSSGLVSIDRLNQAVTRILATKLSQGLMNEAGQ
FIGQIPEKPILKTSEHLEIASKIAKHSVTLVKDRDQLLPLSPQKTPRVRLVVLGDSDEGG
FKEGGKVTDLFKNGLDQLGFEVSLYQMDFHEMFEEGTTDLEGKFDLAFYVANVETASNQT
TTRLNWIQLMAANAPWFAPSIPTVFVSTANPYHLFDVPYISTFINAYTGTPENVAAVLRK
VTGQEEFTGINPIDPFCGDFVATL
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatctaacacaaaaaccttacttattaactactaaacaagcagaaagtatccaa
caactcgtctcagaaatgacaacagaagaaaaaatcggtcagctcttttttgttattgga
caagatgaagagcgcgtctctctggatgactttattgacacctataaaccaggtgggctc
atgttccgaccgggaccagcggcccaaatcagtcgacaaattaaacaaattcaacatcat
agcaaattccctctcttttttgctgcgaatcttgaatccgggggaaatggaatcatcagc
gaggggacttggctaggaaatcctctacaaatggctgcgacgaatgatcctcaagcagcc
tttgaactaggaaatatcgcaggctatgaagccaatcaggtcggatgcaacatgtccttc
tcccctattgtagatattgatttaaattttaaaaatcctattacaaatacacgaaccttc
ggatcagatcctgatcgcgtcctccgtatggcaaaagctcaaattcaaggcctagaagca
aacggaattactcctgtaatcaaacacttcccaggagatggcgttgatgagcgtgatcaa
catttactttccagcattaatagcctatcagcagaagattggtctagcagttatggccag
atttacaaaagcttgattgatcaaggaacaccttgtgtcatgattgggcatatctaccaa
ccagcttgggaacgtaagctaagccccgaaatcaaagatcaggacctacgccccgcctca
gcctctaaactcctcattgacggcctccttcgaacagaacttggtttcaatggattggcc
attactgatgcgaccgctatggtgggctataatgtcattctcccacgtaaagaacttcta
cctgcaaccattaatgccggaatcgatatgattctctttaacaaaaacattgatgaagat
tatgccattatgacagaagctgttagcagtggccttgtttcaatcgatcgtcttaatcag
gctgtgacccgaatattagcaactaaactttctcaaggtttgatgaacgaagcgggacaa
tttattgggcaaattcctgaaaaaccaatcctaaaaactagtgaacacttagaaatagct
tctaagattgctaaacactctgtcactctcgtaaaagatcgtgatcaactccttcctctc
tctccccaaaaaacaccccgtgttcgtctagttgtcctaggtgattctgatgaaggtggc
tttaaagaaggtggtaaagtaacagacctctttaaaaatggcttagatcagttaggtttc
gaagtctccctctatcagatggacttccatgaaatgtttgaagaaggaacaacggattta
gagggaaaatttgaccttgctttttacgtagcaaatgtggaaacagccagcaaccaaacg
actactcgtcttaactggatccagctcatggcagccaatgctccttggtttgctccatcc
attcctactgtatttgtttcaacggcaaacccttatcacctctttgatgtcccttatatt
tcaacatttatcaacgcttatacaggaactcctgaaaatgtagctgcagttttaagaaaa
gtgactggccaagaagagttcacaggtataaaccctattgatccattctgtggtgatttc
gtagctacattgtaa

DBGET integrated database retrieval system