KEGG   Streptococcus parasanguinis FW213: Spaf_1815Help
Entry
Spaf_1815         CDS       T02115                                 

Gene name
recD
Definition
helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:scf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Spaf_1815 (recD)
Enzymes [BR:scf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Spaf_1815 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1836255..1838723
Genome map
AA seq 822 aa AA seqDB search
MSQPCFIKRKEMMEYYFSGTIERIIFENPSSFFRILLLDISDTDAEDFDDFEIIVTGTMA
DIMEGEDYTFWGELVHHPKYGEQLKISRYERAKPSSKGLVKYFSSDHFKGIGLKTAQKIV
DLYGDNTIDKILEAPEKLEEITGLSKKNRLVFVDKLRQNYGTERILAQLANYGIPNKLAF
QIQDFYKEETLQIVEQQPYRLVEDIQGLGFKIADQLAEELGIASDAPERFRAGLIHSLFS
YSIETGNTYIEAKDLLRYSIDLLESARPVELDPSTVAQELGHLIEEDKVQNVDTKIFDNS
LFFAEEGIRSHIGRLLEKGKQTSFDPEKINQAIKEVEKDLGIHYDAIQKEAIHQAIQNKV
FILTGGPGTGKTTVINGMISVYAQLHQLDLRKKQDLPILLAAPTGRAARRMNELTGLPSA
TIHRHLGMTGDDDTSHLEDYLDADFIIVDEFSMVDTWLANQLLNNIATDTKLLIVGDADQ
LPSVSPGQVLADLLQIPSIPQTKLEHIFRQSEDSTIVSLAGDIRQGKLPQDFTERKADRS
YFEAGSEHIPKMIEQITSAALRSQIPARDIQVLAPMYKGQAGIDNINTLMQDLLNPAVKD
QVVFDSPDCQYRDGDKVIHLVNDAESNVFNGDIGYITDLLPGKYTESKQDELTIQFDGNE
IVYPRNEWYKIRLAYAMSIHKSQGSEFPVVILPITNQSHRMLQRNLIYTAITRSKSKLIL
LGEYSAFDFATKNTGTARKTYLVERFKNLDGGEATTDYSSSVATASATVESARSKEGTVE
TKAETSKPTVYRLTEDNLHAISPMIGLTEEEIAAFFDIKQPN
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagccttgctttataaaaaggaaagaaatgatggaatattatttttctggtact
attgagcgcattatttttgaaaatcccagtagtttttttcgaatcctccttctcgacatt
agcgataccgatgccgaagactttgatgattttgagattattgtgacgggcaccatggca
gatatcatggaaggcgaagactacaccttctggggggagctggtccatcatcctaaatac
ggagaacagctcaaaatcagccgctatgaacgggctaaaccctctagcaagggcttggta
aaatatttttccagcgatcacttcaagggaattggtctcaaaacagcccaaaaaatcgtg
gacctctatggggacaataccattgacaaaattctggaagcacctgaaaaattagaagaa
atcacaggcctctccaagaaaaaccgcctggtttttgtggataaactccgtcagaattac
ggaacggagcgtattctcgcccaactagccaattatggcatccccaataaactagccttt
caaatccaggatttctacaaggaagaaaccctccagatcgtggagcaacagccctaccga
ttggtggaagatatccaaggcttgggttttaaaatcgcggaccaactggcagaagaattg
ggcatcgcaagtgacgcccccgagcgtttccgcgcgggtctgattcacagtctcttcagc
tactctatcgagactggaaatacctatattgaagccaaagacctcctgcgctatagcatt
gaccttttggaatcagcgcgtccagtagaattggatccttctactgtcgcccaagaatta
ggccacctcatcgaggaagacaaggtccaaaatgtggataccaagatctttgacaatagc
cttttctttgcggaagaagggattcgtagtcacattggtcgattgctggagaaaggaaag
cagacttcatttgaccctgagaaaatcaaccaggcaattaaagaggttgaaaaagatctg
gggattcactacgatgcgattcaaaaagaggcgattcaccaggcgattcaaaacaaggtc
tttatcctcactgggggtccagggacaggaaagaccaccgttatcaatgggatgattagt
gtctatgcccaactccaccagctggatcttcggaagaaacaagacctgccgatcctcttg
gctgccccaacgggacgggcagctaggcgcatgaatgagctaacagggcttccgagcgcc
accatccaccgtcatttggggatgactggggatgatgacaccagccacttagaggactat
ctggatgcagactttatcattgtggacgaattttccatggttgatacctggctggccaat
caattacttaacaacatcgcaacggataccaaactcttgattgtgggagatgccgaccaa
ttaccttccgtcagccctggtcaggtcttggctgatctcttgcagatcccaagcatccct
cagaccaaactggaacatattttccgccagagtgaagattcgaccattgtctccctggca
ggagacattcgccagggcaagctccctcaagatttcacagaacgaaaagccgaccgctct
tatttcgaagccggaagcgaacacatccctaagatgatcgaacagatcacctctgctgcc
cttcgcagtcagatcccggctcgagatatccaagtcttggcaccgatgtacaagggccag
gccggcattgacaacatcaatacactcatgcaagaccttctcaatccagctgtcaaagac
caggtcgtctttgactcgccagactgccaataccgcgatggagataaggtcatccatctg
gtcaatgatgcagaaagcaatgtctttaatggagatattggctacattaccgatcttctc
cccggaaaatatacagaatcgaagcaagatgaattgactatccaatttgatggcaatgaa
atcgtctacccgcgcaatgaatggtacaagattcgcttagcctatgcgatgagtattcac
aaatcgcaaggaagcgaatttcctgtggtgattttacccattacgaatcaaagccaccgg
atgttgcaacgtaatttgatctataccgccatcacgcgctcaaagagcaagctgattctc
ttaggagaatacagcgcctttgatttcgctactaaaaatacaggtacagcgcgcaagacc
tatttggttgaacgcttcaagaacctggacggaggcgaggcaaccacagactattcttca
tccgttgcaacggcttctgctacagtcgaatctgcacgaagcaaggaagggactgttgaa
acgaaagcagagacgtctaagcctactgtctatcgactaacagaagacaatctccacgcc
atctcgcctatgattggactaacagaagaagagattgcagccttctttgatatcaaacaa
cctaattga

DBGET integrated database retrieval system