KEGG   Streptococcus parasanguinis FW213: Spaf_1936Help
Entry
Spaf_1936         CDS       T02115                                 

Gene name
gltX1
Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:scf00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1965235..1966692)
Genome map
AA seq 485 aa AA seqDB search
MAKDIRVRYAPSPTGLLHIGNARTALFNYLYARHHGGTFIIRIEDTDRKRHVEDGERSQL
ENLRWLGMDWDESPETHENYRQSERLELYQKYIDQLLAEGKAYKSYVTEEELAAERERQE
AAGETPRYINEYLGMREEEKAAYIAEREAAGVIPTVRLAVNESGIYKWHDMVKGDIEFEG
GNIGGDWVIQKKDGYPTYNFAVVIDDHDMQISHVIRGDDHIANTPKQLMVYEALGWEAPE
FGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYLPEAVFNFIALLGWNPGGEDEIFSR
EELIKLFDENRLSKSPAAFDQKKMDWMSNEYIKNADLATIFEMAKPFLEEAGRLTDKAEK
LVELYKPQMKSVDEIVPLTDLFFSDFPELTEAEKEVMAGETVPTVLEAFKAKLEAMSDDE
FVAENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPETIYLLGREKSIQHIESM
LEKIR
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagatattcgtgtgcgttatgcaccaagtccaacaggcctactacacatcgga
aatgctcgtacggcattgtttaactacttgtatgcgcgtcaccatggtggaacctttatc
atccgtatcgaggatacggaccgcaaacgtcacgtcgaagacggcgaacgttcacagctt
gaaaaccttcgttggttgggcatggactgggatgaaagcccagagacgcatgaaaactac
cgccagtctgagcgtttggaactctatcaaaaatacatcgaccaactattggcggaagga
aaagcctataaatcttacgtcactgaagaagagttggcagctgaacgtgaacgccaagaa
gcagcgggtgaaacacctcgctacatcaacgaataccttggcatgagagaagaagaaaaa
gctgcttatatcgcagaacgtgaagcagcgggtgtgattccaacggttcgtttggcagtg
aatgagtcaggtatctacaaatggcacgacatggtcaaaggcgatatcgagtttgaaggt
ggcaatatcggtggggactgggtcatccaaaagaaagatggttatccaacttacaacttt
gccgttgtgatcgatgaccacgatatgcaaatctctcacgtcatccgtggagacgaccac
attgccaatacaccaaaacagcttatggtctatgaagctcttggctgggaagcgccagag
ttcggtcacatgaccttgatcatcaactctgaaactggtaagaagttatctaaacgtgat
accaatacccttcagttcatcgaagattaccggaagaaagggtaccttccagaagcagtc
tttaactttatcgctttgcttggttggaaccctggtggggaagacgaaatcttctctcgc
gaagaacttatcaagctctttgatgaaaaccgtctcagcaagtctccagcagcctttgac
cagaagaaaatggactggatgagcaatgagtacattaagaatgcggatctagcgaccatc
tttgaaatggccaaaccattcctcgaagaagcaggacgtttgacagacaaggctgagaaa
ttagtggaactttacaaaccacaaatgaagtcagtggatgaaatcgttccattgacagac
ctcttcttctcagacttcccagaattgaccgaagcagagaaagaagtcatggctggtgaa
accgtgccaactgtccttgaagccttcaaagcgaaacttgaagccatgtcagacgatgag
tttgtggctgaaaatatcttcccacaaatcaaagcagtccaaaaagaaacaggtattaaa
gggaagaaccttttcatgccgattcgtatcgctgtttctggagagatgcatggtccagaa
ttgccagaaaccatctacttgcttggacgcgaaaaatccatccaacacattgaaagtatg
ttggaaaaaatcagataa

DBGET integrated database retrieval system