KEGG   Streptococcus parasanguinis FW213: Spaf_1954Help
Entry
Spaf_1954         CDS       T02115                                 

Gene name
galU
Definition
glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:scf00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:scf00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:scf00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:scf00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2000400..2001308
Genome map
AA seq 302 aa AA seqDB search
MTKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILVVTGKA
KRSIEDHFDSNFELEYNLEQKGKTDLLKLVNDTTAINLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITNDDALPLTKQLMNDYDETHASTIAVMEVPHEEVSSYGVIAPQG
EGINGLYSVETFVEKPNPEDAPSNLAIIGRYLLTPEIFAILENQEPGAGNEIQLTDAIDT
LNKTQRVFAREFTGDRYDVGDKFGFMKTSIDYALKHPQVKDDLKQYIIELGKELEASEKT
AD
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagttagaaaagccgtcattcctgcggctggtttggggacacgcttcctcccg
gctactaaagccttggccaaggaaatgttgccaatcgttgacaaacctacgatccaattt
atcgtagaagaggctctgaaatctgggattgaggaaatccttgtcgtaacagggaaggct
aaacgttcgatcgaagaccatttcgattctaacttcgaattagaatacaatctcgagcaa
aaaggcaagactgacttactcaagttggtcaatgatacaacagcgatcaatcttcacttc
atccgccaaagtcaccctcgaggtttaggagacgcggttcttcaagcgaaggcctttgtt
ggaaacgagccttttgtcgtcatgctgggagatgacctcatggacatcactaatgatgat
gccttgccacttaccaaacaattgatgaacgactacgatgaaacccatgcgtcaactatc
gctgtgatggaagtccctcacgaagaggtttcttcttacggtgtgatcgcacctcaaggc
gaagggattaacggtctttatagcgttgaaacttttgtcgaaaaaccaaacccagaggat
gcgccaagtaatctcgctatcattggacgctacctcttaactcctgagatctttgcgatc
cttgaaaatcaagaaccaggcgctggaaatgaaattcaattgacggatgcgattgacacg
ctcaataaaacacagcgcgtctttgctcgtgaattcactggagatcgctatgacgtcggt
gataaattcggctttatgaaaacttcgatcgactatgccttgaaacaccctcaagtcaaa
gatgatctcaaacaatatattatcgaactcggaaaagaattagaagcgtctgaaaaaact
gcagactaa

DBGET integrated database retrieval system