KEGG   Streptococcus parasanguinis FW213: Spaf_2048Help
Entry
Spaf_2048         CDS       T02115                                 

Gene name
malQ
Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
scf00500  Starch and sucrose metabolism
scf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Spaf_2048 (malQ)
Enzymes [BR:scf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Spaf_2048 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: AFJ26983
UniProt: I1ZPK9
Position
complement(2109037..2110566)
Genome map
AA seq 509 aa AA seqDB search
MKKRQSGVLMHISSLPGQYGIGSFGQSAYDFVDFLVRTKQRYWQILPLGTTSYGDSPYQS
FSAFAGNTHFIDFDLLIKQGLLTEADLEGVDFGQDPSQVDYAKVFEQRRPLLEKAVANFL
KSSDQKEFQAFCEANASWLELFAEYMAIKEHFDLKAWTEWPDATIRGRQPEALAHYREEL
ADKLTYHRVTQFFFFQQWLALKAYANDHHIEIVGDMPIYVAEDSSDMWANPHLFKTDENG
KATCIAGCPPDEFSATGQLWGNPIYDWEAMDKDGYQWWIERLRESFKIYDIVRIDHFRGF
ESYWEIPAGSETAAPGKWVKGPGYKLFAAVKEKLGDLNIIAEDLGFMTDEVIELRERTGF
PGMKILQFAFNPDDESIDSPHLAPNNSVMYTGTHDNNTVLGWYRNEIDDPTREYLARYTN
RKEYESVPHAMLRTVFASVSFMAIATMQDLLELDGSARMNFPSTLGGNWSWRMTEDQLTP
AVEQELLDFTTIYRRENKDLKKEAKKAEK
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgtcaaagtggtgttttgatgcacatttcttcccttcctggacaatacgga
atcggatcattcggacaatcagcttatgattttgttgatttcctcgttcggaccaagcaa
cgttactggcaaattttgccacttggtacaactagttatggagattctccataccaatct
ttctcagcttttgctggaaacactcattttattgatttcgatcttttgatcaaacaaggt
ttgttgacagaagcagaccttgaaggagtggactttggtcaagatccttctcaggttgat
tatgcaaaagtttttgagcaacgtcgtcccctgcttgaaaaagcagttgcgaatttctta
aaatcaagtgatcaaaaagaattccaagctttttgcgaagccaatgcttcttggttggag
ctattcgcagaatacatggctattaaagaacactttgatttaaaagcgtggacagagtgg
ccagatgctaccattcgtggacgtcaacctgaagccttggcgcactaccgtgaagaattg
gcggataaattgacttaccatcgtgtgactcaattcttcttcttccaacaatggttggcc
ttgaaagcttatgccaacgaccaccacattgaaattgtgggtgatatgccaatctatgta
gcagaagattcaagcgacatgtgggctaatcctcatctcttcaaaacggatgaaaacggg
aaggcgacttgcattgcaggatgcccgccagatgagttctcagcaactggtcaactttgg
gggaacccaatctatgactgggaagcaatggacaaagatggctaccaatggtggattgaa
cgcttgcgtgaaagcttcaagatctacgatatcgttcggatcgaccacttccgtggtttc
gaatcatactgggaaatcccagctggttctgaaactgccgcacctggtaaatgggtcaaa
ggtcctggctacaaactctttgcagcagtgaaggaaaaactcggtgatttgaacatcatc
gctgaggaccttggctttatgacggatgaagtcattgagcttcgcgaacgtactggcttc
ccaggaatgaagattcttcaatttgccttcaatcctgacgatgaaagtatcgatagccct
cacttggcaccaaacaactctgtgatgtacactggaacacatgataacaacacagttctt
ggatggtaccgcaatgaaatcgacgatccaactcgtgagtaccttgctcgttataccaac
cggaaagagtacgaatctgtaccgcatgctatgcttcgtacagtctttgcttccgtcagc
ttcatggcgattgctactatgcaagacttgctcgagttggatggttcagctcggatgaac
ttcccatcaactcttggtggtaactggtcatggcggatgacagaggatcaattgactcca
gctgtcgagcaagaattgcttgatttcacaacgatctatcgtcgtgaaaacaaagacttg
aaaaaagaagctaagaaagcagaaaaataa

DBGET integrated database retrieval system