KEGG   Streptococcus constellatus subsp. pharyngis C1050: SCI_0144Help
Entry
SCI_0144          CDS       T02832                                 

Definition
penicillin-binding protein
Orthology
K12555  
penicillin-binding protein 2A [EC:2.4.1.129 2.3.2.-]
Organism
scg  Streptococcus constellatus subsp. pharyngis C1050
Pathway
beta-Lactam resistance
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:scg00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SCI_0144
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SCI_0144
Enzymes [BR:scg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     SCI_0144
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     SCI_0144
Glycosyltransferases [BR:scg01003]
 Polysaccharide
  Bacterial polysaccharide
   SCI_0144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
133694..135913
Genome map
AA seq 739 aa AA seqDB search
MKKLSELFEIVVNHFKKDSPERNHQEVTEVEESESHLSRSGKSRKKPISQHPFRRFWRRY
HLTKIVLILGLGFGLVTGGYLFYVAKSTNVNDLQNALKATTSIYDKDGKKAGSLSGQKGT
YVELSKISPNLQHAVIATEDRSFYKNSGINYGRFILAILTAGRSGGGSTITQQLAKNAYL
SQDQTIERKAKEFFLALELTKKYSKKQILTMYLNNSYFGNGVWGVEDASKKYFGVSASQL
TLDQSATLAGMLKGPELYNPLASIKNATNRRNTVLQNMVAAGYINQNTANQAAANGLGSQ
LVDAYTGKSADYRYPSYFDAVINEAVRDYGLTEADIVNNGYRIYTELDQNYQASMQVIYD
RKDLFPQAADGTRAQSGSVALDPKTGGVRALVGQINSTSANFRSFNYATQSARSPGSTIK
PLAVYSPAVDAGWSINKELDNSTTTYGNYTVNNYAGIQSSPTVPMYQALAQSLNIPAVAA
ANELGLKKVFEYGKKFGLNMDKVSQTLGVALGSGVTTNPLQMAQAYSTFANNGVMNDAHL
ITKIENASGQVVKTHKSTSTRVLNRSTTEKMTSMMLGTFTNGTGVYAAPYGYTMAGKTGT
TETNFNPDLSGDQWVIGYTPDVVISQWLGFPKTDENHYLTGTSANEASAIFRSVANSILP
YTRGTKFGDENAYAKNGIAPVDTSGTNNTTNQSDNRSDVLKDVQDKAKNLVDQAKKAIDD
AKIPEKAKNLWDTVKSWFQ
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattgagtgaattatttgaaatagtagtgaatcattttaaaaaggacagtcct
gagcgcaaccatcaagaggtgacagaggtagaagaaagcgaatcgcatttgagccgttct
gggaaaagccgaaaaaagccaatttctcagcatccatttcgtcgattttggcgtcgctat
cacctgacgaagattgttttgattctgggacttggttttggtttggtgacagggggctat
ctcttttatgttgccaaatccactaatgtgaatgatttacagaatgcgttgaaagcaacg
acatcaatttatgataaggacggaaaaaaagcgggcagcttgtcagggcaaaagggaact
tacgtagaattgtccaaaattagtccgaacttacaacatgccgtcattgcgacagaagac
cgttccttttataaaaatagtggtattaactacggtcgttttattctagcaattttaacg
gctgggcgttctggtggtggttctaccattacacaacaattagctaaaaatgcttactta
tctcaggatcagaccattgagcggaaggcaaaagagtttttcctagctttagaattaact
aaaaaatatagtaaaaagcagattctcactatgtacctcaataattcttattttggaaat
ggtgtttggggtgtagaagatgcctctaaaaagtacttcggcgtatctgccagtcagttg
accctcgaccaatctgctactttagcaggaatgctcaaaggaccggaactatataatccg
cttgcttctatcaaaaacgcaacgaatcgacgcaatactgttttacaaaatatggtagca
gcaggttatatcaatcaaaatactgcaaaccaagcagcagcaaacggtttaggtagtcaa
ttggtagatgcttatacaggaaaatcggcagattatcgttatccgtcttactttgatgcg
gttatcaatgaagcagtacgtgattatggcttgacagaagctgatattgtcaataacggc
tatcgcatttacacagagctagatcaaaattatcaagctagcatgcaagtcatttatgac
cgcaaagatttgttcccacaagcagcagatggtacgagggcccaatctggcagcgtagca
ctagaccctaaaacgggaggagttcgtgcgcttgttgggcaaatcaatagtacgagtgcc
aatttcagaagttttaattatgctacacaatccgcaagaagtcctggctccactattaag
ccattagcagtttacagtcccgcagttgatgcaggttggtctatcaataaagaattggat
aatagtacaacaacgtatggaaattataccgtgaataactatgctgggattcaatccagt
ccgactgtaccaatgtatcaggctttagcacaatccttaaatattcccgcagttgcggct
gccaatgaattggggctgaaaaaggtttttgaatatggtaaaaaatttggcctgaatatg
gataaagtgagtcagacccttggggtagctcttggtagtggcgtaacaactaatccactg
caaatggcacaagcttattctacttttgcaaataatggggttatgaatgatgcgcatttg
attaccaaaattgaaaatgctagtgggcaagtcgttaaaactcataaatccacctcgact
cgagtactcaaccgctcaacaacagaaaaaatgacgagtatgatgctgggaacatttacc
aatggtactggtgtgtatgcagcaccttatggctatactatggctggaaagacgggaacg
acagaaactaactttaatccagatttatcaggagaccaatgggttattggttacacgcca
gatgtggttatcagtcagtggttaggttttccaaagacagatgaaaatcattatctgaca
ggcacaagtgccaatgaagcttcagctattttccgaagtgtggcaaatagtatcttaccg
tatacaaggggtacgaagttcggtgatgaaaatgcctatgcaaaaaatggtattgcaccg
gttgatacgagtggtacaaataacactacgaatcaaagtgacaatcgttcagatgtcttg
aaagatgtgcaggataaagctaagaacttggttgaccaagctaaaaaagcaattgatgat
gctaaaattcctgaaaaagcgaaaaatctttgggatacagtcaagagttggttccaatag

DBGET integrated database retrieval system