KEGG   Sphingobium chlorophenolicum: Sphch_0109Help
Entry
Sphch_0109        CDS       T01522                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
sch  Sphingobium chlorophenolicum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:sch00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sch02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(122280..122954)
Genome map
AA seq 224 aa AA seqDB search
MGRMRGMAVGLCIAGAAMTVLSLGWFSDKLYTRVRPGQLAYKPMEEMPPRVDMASIQRDW
PASFSEPGEGSRVIAYQRTMRGKAPAPGAAGDAAPAAPPPDLGTLLAGADAGAGKQKIQL
CMSCHDFTQGGANRIGPNLWGVVGRPVASHAGFAYSPAMQAHKGSWDYEALFAFLGSPGR
VVPGTKMSFAGLRRPEDRAAVIKYLATLGTGAPPLPQPKAMAAR
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgggcaggatgcgcgggatggcggtggggctgtgcattgccggggcggcaatgacggtg
ttgagcctgggatggttcagcgacaagctctacacgcgggtgaggccggggcaactggcc
tataaaccgatggaggagatgccgccgcgcgtggacatggcttcaatccagcgcgattgg
cccgccagtttcagcgagccgggggaaggcagccgggtgatcgcctatcagcggaccatg
cgggggaaggctcccgcgccgggcgcggccggcgacgctgcgcctgccgctcccccgccc
gatctgggcaccctgctcgccggtgcggatgcgggcgcgggaaagcagaagatacagctt
tgcatgagttgccacgacttcacccagggaggggccaatcgcatcgggccgaacctgtgg
ggcgttgtggggcggccggtggcgagccatgcgggcttcgcctattcccccgccatgcag
gcgcataaggggagctgggattatgaggcattgttcgccttcctcggctcgccggggcgg
gtggtgccgggaacgaagatgagcttcgcgggattgcgcaggccggaggatcgggcggcg
gtgatcaaatatctggcgactttgggaaccggagcgccgcccctgccccaaccgaaggcc
atggccgcgcggtag

DBGET integrated database retrieval system