KEGG   Sphingobium chlorophenolicum: Sphch_0109Help
Entry
Sphch_0109        CDS       T01522                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
sch  Sphingobium chlorophenolicum
Pathway
sch02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sch00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sphch_0109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: AEG47811
UniProt: F6EU04
Position
1:complement(122280..122954)
Genome map
AA seq 224 aa AA seqDB search
MGRMRGMAVGLCIAGAAMTVLSLGWFSDKLYTRVRPGQLAYKPMEEMPPRVDMASIQRDW
PASFSEPGEGSRVIAYQRTMRGKAPAPGAAGDAAPAAPPPDLGTLLAGADAGAGKQKIQL
CMSCHDFTQGGANRIGPNLWGVVGRPVASHAGFAYSPAMQAHKGSWDYEALFAFLGSPGR
VVPGTKMSFAGLRRPEDRAAVIKYLATLGTGAPPLPQPKAMAAR
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgggcaggatgcgcgggatggcggtggggctgtgcattgccggggcggcaatgacggtg
ttgagcctgggatggttcagcgacaagctctacacgcgggtgaggccggggcaactggcc
tataaaccgatggaggagatgccgccgcgcgtggacatggcttcaatccagcgcgattgg
cccgccagtttcagcgagccgggggaaggcagccgggtgatcgcctatcagcggaccatg
cgggggaaggctcccgcgccgggcgcggccggcgacgctgcgcctgccgctcccccgccc
gatctgggcaccctgctcgccggtgcggatgcgggcgcgggaaagcagaagatacagctt
tgcatgagttgccacgacttcacccagggaggggccaatcgcatcgggccgaacctgtgg
ggcgttgtggggcggccggtggcgagccatgcgggcttcgcctattcccccgccatgcag
gcgcataaggggagctgggattatgaggcattgttcgccttcctcggctcgccggggcgg
gtggtgccgggaacgaagatgagcttcgcgggattgcgcaggccggaggatcgggcggcg
gtgatcaaatatctggcgactttgggaaccggagcgccgcccctgccccaaccgaaggcc
atggccgcgcggtag

DBGET integrated database retrieval system