KEGG   Sphingobium chlorophenolicum: Sphch_0128Help
Entry
Sphch_0128        CDS       T01522                                 

Definition
(RefSeq) succinyl-CoA ligase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sphch_0128
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sphch_0128
   00640 Propanoate metabolism
    Sphch_0128
   00660 C5-Branched dibasic acid metabolism
    Sphch_0128
Enzymes [BR:sch01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Sphch_0128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:139062..140261
Genome map
AA seq 399 aa AA seqDB search
MNIHEYQAKELLAKYGAPIAAGYAAFSVEEAVEAAKKLPGPLYVVKSQIHAGGRGKGKFK
ELGPDAKGGVRLAFNLDEVKAHATDMLGNTLVTIQTGEAGKQVNRLYITDGADIAKEFYL
ALLVDRASSRVAFVVSTEGGMDIEEVAHSTPEKIHSFSVDPASGFQPHHGRAVAAALGLS
GDQAKQAAKVASSLYAAFLDTDAEQIEVNPLALTEQGNLLVLDAKVGFDGNAMFRHKDIA
ELRDLTEEDPAEVEASEYDLAYIKLDGNIGCMVNGAGLAMATMDIIKLNGEFPANFLDVG
GGANKEKVTAAFKIILKDPAVKGILVNIFGGIMKCDIIAEGIVAAAKEVNLSVPLVVRLE
GTNVQQGKDILAASGLAIVPADDLGDAARKIVAEVRKAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgaatatcaggcgaaggaactgctggcgaaatatggcgcgccgatcgcc
gccggttatgccgccttctccgtcgaggaagccgtcgaggccgccaagaagctgcctggg
ccgctctatgtcgtgaagtcgcagatccacgccggtggccgcggcaagggcaagttcaag
gaactcggccccgacgcgaagggcggcgtccgcctggccttcaacctggacgaggtgaag
gcccacgccaccgacatgctgggcaacacgctggtcaccatccagaccggcgaagcgggc
aagcaggtcaaccgcctctacatcaccgacggcgccgacatcgccaaggaattctacctc
gctctgctggttgaccgcgccagcagccgcgttgccttcgtcgtgtcgaccgaaggcggc
atggacattgaagaggtcgctcactcgacccctgagaagatccacagcttctctgtcgac
cccgcttcgggcttccagccgcaccacggccgcgccgtggccgctgcgctgggcctctcc
ggcgatcaggcgaagcaggccgccaaggtcgcctcgtcgctctacgccgcgttcctggac
accgacgccgagcagatcgaagtcaatccgctggcgctcaccgagcagggcaacctgctg
gtgctggacgccaaggtcggtttcgacggcaacgccatgttccgtcacaaggacatcgcc
gaactgcgcgacctgaccgaggaagacccggcggaagtcgaggcttcggaatatgacctg
gcctacatcaagctggacggcaatatcggctgcatggtgaacggcgcgggcctggccatg
gcgaccatggacatcatcaagctgaacggcgaattccccgccaacttcctggacgtcggc
ggcggcgccaacaaggaaaaggtgaccgcggccttcaagatcattctgaaggacccagcg
gtgaagggcattctcgtcaacatcttcggcggcatcatgaagtgcgacatcattgccgag
ggcatcgtcgccgccgcgaaggaagtgaacctgtcggttccgctggtcgtccgcctggaa
ggcacgaacgtccagcagggcaaggacattctcgcggcttcgggcctggccatcgtcccg
gcggacgatctgggcgacgcagccaggaagatcgtggcggaagtgaggaaggcggcctga

DBGET integrated database retrieval system