KEGG   Sphingobium chlorophenolicum: Sphch_0256Help
Entry
Sphch_0256        CDS       T01522                                 

Definition
orotidine 5'-phosphate decarboxylase (EC:4.1.1.23)
Orthology
K01591  
orotidine-5'-phosphate decarboxylase [EC:4.1.1.23]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sch00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(264601..265275)
Genome map
AA seq 224 aa AA seqDB search
MTSPIYVAIDTPDLRKAQSLAQQVRHHVGGLKLGLEFFCAHGHHGVHEMMKFGLPIFLDL
KLHDIPNTVAKAVQALHVLEPAILTVHAAGGRAMLEDAKAAAGVNTKVVAVTVLTSLDDG
DLLDIGVGGRAEDQVARLADLAHSAGLDGIVCSGEEVGLAKKAWPEGFFVVPGVRPAGGA
LGDQKRAVTPREALDRGASILVVGRPISLAENPDIAAREIEATL
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcccgatctacgtcgccatcgatacgcccgacctgcgcaaggcccagtcactc
gcgcagcaggtgcgtcatcatgtgggcgggctgaagctgggcctggaatttttctgcgcc
catggccatcatggggtgcatgagatgatgaagttcgggctgccgatcttcctggacctg
aagctgcacgacattcccaataccgtggccaaggcagtgcaggcgctgcatgtgctggaa
ccggcgatcctgaccgtccatgcggcgggcgggcgcgccatgctggaggatgcgaaggcg
gctgcgggcgtcaataccaaggtcgtcgcggtgacggtgctcaccagcctggatgatggc
gacctgctggacatcggcgtcggtggccgggcggaggatcaggtggcgcggctggcggat
ctggcgcacagcgcggggctggacgggatcgtctgttccggcgaagaggtcgggctggcg
aaaaaggcctggccggaagggtttttcgtggtgccgggggttcggcccgccggtggggct
ttgggcgaccagaagcgcgctgtgacgccacgagaggcgctggatcgcggggcttcgatc
ctggtggtcgggcggccgatcagcctggcggagaatccggatatcgctgcgcgggagatt
gaggcgacgctttag

DBGET integrated database retrieval system