KEGG   Sphingobium chlorophenolicum: Sphch_0312Help
Entry
Sphch_0312        CDS       T01522                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:sch00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:312912..313577
Genome map
AA seq 221 aa AA seqDB search
MADSIPIETPDFKRRGVLFVLSSPSGAGKSTIARKLLAAEPDLAMSVSATTRPMRPGEVD
GKDYHFVDLEEFRRMTANHEFLEWAHVFGQRYGTPRAPVEAMLKSGRDVLFDIDWQGAQQ
LHQIAGGDVVRIFILPPSMEELERRLRGRATDSNEVIEGRMSRAAGEIAHWDGYDYVLCN
VDADDCFRRVQTILHAERMKRSRQTGLIGFIRKLSRYHQED
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggccgacagcattcccatcgagacgcccgatttcaagcgccgcggcgtcctgttcgtt
ctttcctcgccttcgggcgccggtaaatccaccattgcgcgcaaattgctcgccgccgag
ccggatttggcgatgtcggtgtccgcgacgacgcggccgatgcggccgggtgaagtcgac
ggcaaggattatcatttcgtcgatctggaggaattccggcggatgaccgccaatcatgag
ttcctggaatgggcgcatgtgttcggccagcgctacggcacgccgcgcgcgccggtggag
gcgatgctgaagtcggggcgcgacgtgctgttcgacatcgactggcagggcgcgcagcag
ttgcaccagatcgccgggggcgatgtcgttcgcatcttcatcctgccgccgtcgatggag
gagctggagcggcgtttgcggggccgggcgacggacagcaatgaagtgattgagggccgc
atgtcccgcgccgccggagagatcgcgcattgggacggctatgattatgtcctgtgcaat
gtcgatgccgacgattgcttccggcgggtccagaccatcctgcatgccgaacgcatgaag
cgcagcaggcagacggggctgatcggtttcatccgcaagctcagccgttatcatcaggaa
gattga

DBGET integrated database retrieval system