KEGG   Sphingobium chlorophenolicum: Sphch_0453Help
Entry
Sphch_0453        CDS       T01522                                 

Definition
amine oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sphch_0453
Enzymes [BR:sch01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Sphch_0453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(472211..473545)
Genome map
AA seq 444 aa AA seqDB search
MGKSVVVIGAGIAGMSAAFDLQSAGYEVTVIESGNFVGGRMADQDINGINVHTGASVIFS
FNKAMFDLIDELGISDDLYAFPDKNEGYNVEHGDETYKLKLTFDPIFLLTHPAFGFKTKA
KLAALLPDMIKAGLQTDPCMMHTAAHLDDENVTDYITRKVTKEFLEKYVEPYFRAPWHWE
PEQISRAYLLSLLGHIVGGKLLSFKTGIGHLSRTLGNRLDVKLNTRVVEAGYDDSGCRLT
IEHDGATEAVTCDFVVCAIPGTLVNSVVKGLSTDAEAFFDTVRYNRGARIYYAVDGVQLQ
PRDTWFTRHSACKFSLFYAMPTDSLVPEGFKQPQYLQCELSPQLSEAIEKEGGQQRLDSY
VRDELERLCPEAAGKVTAVAEQWWDNMLTEWYPGYTKGMAEFLKQQEDTPARMYFCGDYL
SQSHTGGACASGRGVAAAIRRHWE
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
gtggggaaatcagtcgtcgtaattggagccgggatcgcaggcatgtcggccgcctttgat
cttcagtcggcgggctacgaagtaaccgtgatcgagagcggaaattttgtgggtggtcgc
atggccgaccaggatatcaatggaatcaacgtccacaccggcgcatccgtgatcttttcg
ttcaacaaggcgatgttcgatttgatcgacgagctaggaataagcgatgatctgtacgca
tttccggacaaaaatgaggggtataacgtcgaacatggcgatgagacctacaaactcaag
ctgaccttcgacccgatcttcctgctgacacatcccgctttcggtttcaaaacaaaggcg
aagctggcggccctgttgccagacatgatcaaggcaggtcttcagaccgatccctgtatg
atgcatacggctgcgcatctggatgacgagaacgtcacggattacatcacgcggaaggtg
acgaaagagttcctcgaaaaatatgtcgagccctatttccgggcgccctggcactgggag
cccgagcagatttcgcgcgcctatctcttgagcctgctcggccacatcgttggcggcaaa
cttctcagtttcaaaaccggcatcgggcatctcagccgaacgctgggcaaccggctcgac
gtcaagctcaacacgagggtggttgaagccggatatgacgacagtgggtgtcgtctcacg
attgagcatgacggcgcgactgaggcggttacctgcgactttgtcgtttgcgccattccc
ggtacgctggtgaacagcgtggtcaaaggcctgtccaccgacgccgaggcctttttcgac
accgtccgatacaatcgcggcgcgcggatctactatgcggtcgacggcgtccagttgcag
ccccgagatacctggttcacgcgccattcggcgtgcaaattttctctcttctacgcgatg
ccaaccgacagtctggtgcccgaaggattcaagcagccgcaatatcttcagtgcgaactg
tcaccccagctttcggaagcgatcgaaaaagagggcggtcaacagcgcctcgattcctat
gtcagggatgagcttgagcgcctttgtcccgaagcggctggcaaggtcaccgcagtggca
gagcaatggtgggataacatgctcaccgaatggtatccgggctacaccaagggcatggcc
gagtttctgaagcagcaggaagacacgccggcgcgcatgtatttctgcggggactatctc
tcccaatcgcacactgggggcgcctgcgcgagcggaaggggtgtggccgctgcaattcgg
cgtcactgggagtag

DBGET integrated database retrieval system