KEGG   Sphingobium chlorophenolicum: Sphch_0493Help
Entry
Sphch_0493        CDS       T01522                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sch  Sphingobium chlorophenolicum
Pathway
sch00040  Pentose and glucuronate interconversions
sch00052  Galactose metabolism
sch00500  Starch and sucrose metabolism
sch00520  Amino sugar and nucleotide sugar metabolism
sch01100  Metabolic pathways
sch01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sphch_0493
   00052 Galactose metabolism
    Sphch_0493
   00500 Starch and sucrose metabolism
    Sphch_0493
   00520 Amino sugar and nucleotide sugar metabolism
    Sphch_0493
Enzymes [BR:sch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sphch_0493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEG48190
UniProt: F6EXE3
Position
1:519406..520320
Genome map
AA seq 304 aa AA seqDB search
MWGYMRPIKKAVFPVAGLGTRFLPATKVVPKELLAIIDRPLLQYAVDEAIEAGIEQFIFV
TGRGKGAIEDYFDMAFELETTQIGRGKDISALHGTRMQPGQAVFLRQQEPLGLGHAIWCA
RHIVGDEPFAVLLPDEFMYGSPGCLAQMVAAYERLGGNLLCTLEIPIDQTSSYGVVDPGE
RHGAVVEIKGLVEKPAPGTAPSNLILPGRYILQPEIMQVLGRQEKGAGGEIQLTDAMAAL
IGSQPFNGLTFAGQRFDCGSKAGFIEANLALALDREDIGDHILAYAADLIATIQKGRGLS
RDVA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtgggggtatatgcgaccgatcaagaaagccgttttccccgttgccggactcggaacg
cgatttctgccggcgacgaaggtcgtgccgaaggaattgctggcgattattgaccgtccc
ctgctgcaatatgcggtggacgaagcgatagaggcggggatcgagcagttcatcttcgtg
acgggccgggggaagggcgcgatcgaggattacttcgacatggcgttcgaactggaaacg
acccagatcggccggggcaaggatatttcggcgctgcatggcacgcgcatgcaacccggc
caggccgtcttcctccgtcagcaggaaccgctgggcttgggtcatgccatctggtgcgcg
cggcacattgtcggggacgagcctttcgccgtcctcttgcccgatgaattcatgtatggc
agccccggctgccttgcgcagatggtggcggcttatgaaaggctgggaggcaacctcctg
tgcacgcttgaaatccccatcgaccagacgtccagctatggcgtggtcgatccgggggaa
cgccatggcgccgtggtggagatcaagggcctggtcgaaaagcccgcgccgggcaccgcg
ccgtccaatctgatcctgcccggccgctatatcctccagccggagatcatgcaggtcctg
ggtcggcaggaaaaaggcgcgggcggcgaaatccagctcacggacgcgatggcggcgctg
atcggcagccagcctttcaacggcctgacctttgccggacagcggttcgactgcgggtcc
aaggcaggcttcatagaagcgaacctggccctggctctggatcgtgaagacattggcgat
catatattggcctacgcggccgatttgatcgcaactattcagaagggcagggggctgtcc
cgcgacgtagcctga

DBGET integrated database retrieval system