KEGG   Sphingobium chlorophenolicum: Sphch_0493Help
Entry
Sphch_0493        CDS       T01522                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sch00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sch00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sch00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sch00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:519406..520320
Genome map
AA seq 304 aa AA seqDB search
MWGYMRPIKKAVFPVAGLGTRFLPATKVVPKELLAIIDRPLLQYAVDEAIEAGIEQFIFV
TGRGKGAIEDYFDMAFELETTQIGRGKDISALHGTRMQPGQAVFLRQQEPLGLGHAIWCA
RHIVGDEPFAVLLPDEFMYGSPGCLAQMVAAYERLGGNLLCTLEIPIDQTSSYGVVDPGE
RHGAVVEIKGLVEKPAPGTAPSNLILPGRYILQPEIMQVLGRQEKGAGGEIQLTDAMAAL
IGSQPFNGLTFAGQRFDCGSKAGFIEANLALALDREDIGDHILAYAADLIATIQKGRGLS
RDVA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtgggggtatatgcgaccgatcaagaaagccgttttccccgttgccggactcggaacg
cgatttctgccggcgacgaaggtcgtgccgaaggaattgctggcgattattgaccgtccc
ctgctgcaatatgcggtggacgaagcgatagaggcggggatcgagcagttcatcttcgtg
acgggccgggggaagggcgcgatcgaggattacttcgacatggcgttcgaactggaaacg
acccagatcggccggggcaaggatatttcggcgctgcatggcacgcgcatgcaacccggc
caggccgtcttcctccgtcagcaggaaccgctgggcttgggtcatgccatctggtgcgcg
cggcacattgtcggggacgagcctttcgccgtcctcttgcccgatgaattcatgtatggc
agccccggctgccttgcgcagatggtggcggcttatgaaaggctgggaggcaacctcctg
tgcacgcttgaaatccccatcgaccagacgtccagctatggcgtggtcgatccgggggaa
cgccatggcgccgtggtggagatcaagggcctggtcgaaaagcccgcgccgggcaccgcg
ccgtccaatctgatcctgcccggccgctatatcctccagccggagatcatgcaggtcctg
ggtcggcaggaaaaaggcgcgggcggcgaaatccagctcacggacgcgatggcggcgctg
atcggcagccagcctttcaacggcctgacctttgccggacagcggttcgactgcgggtcc
aaggcaggcttcatagaagcgaacctggccctggctctggatcgtgaagacattggcgat
catatattggcctacgcggccgatttgatcgcaactattcagaagggcagggggctgtcc
cgcgacgtagcctga

DBGET integrated database retrieval system