KEGG   Sphingobium chlorophenolicum: Sphch_0493Help
Entry
Sphch_0493        CDS       T01522                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sphch_0493
   00052 Galactose metabolism
    Sphch_0493
   00500 Starch and sucrose metabolism
    Sphch_0493
   00520 Amino sugar and nucleotide sugar metabolism
    Sphch_0493
Enzymes [BR:sch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sphch_0493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:519406..520320
Genome map
AA seq 304 aa AA seqDB search
MWGYMRPIKKAVFPVAGLGTRFLPATKVVPKELLAIIDRPLLQYAVDEAIEAGIEQFIFV
TGRGKGAIEDYFDMAFELETTQIGRGKDISALHGTRMQPGQAVFLRQQEPLGLGHAIWCA
RHIVGDEPFAVLLPDEFMYGSPGCLAQMVAAYERLGGNLLCTLEIPIDQTSSYGVVDPGE
RHGAVVEIKGLVEKPAPGTAPSNLILPGRYILQPEIMQVLGRQEKGAGGEIQLTDAMAAL
IGSQPFNGLTFAGQRFDCGSKAGFIEANLALALDREDIGDHILAYAADLIATIQKGRGLS
RDVA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtgggggtatatgcgaccgatcaagaaagccgttttccccgttgccggactcggaacg
cgatttctgccggcgacgaaggtcgtgccgaaggaattgctggcgattattgaccgtccc
ctgctgcaatatgcggtggacgaagcgatagaggcggggatcgagcagttcatcttcgtg
acgggccgggggaagggcgcgatcgaggattacttcgacatggcgttcgaactggaaacg
acccagatcggccggggcaaggatatttcggcgctgcatggcacgcgcatgcaacccggc
caggccgtcttcctccgtcagcaggaaccgctgggcttgggtcatgccatctggtgcgcg
cggcacattgtcggggacgagcctttcgccgtcctcttgcccgatgaattcatgtatggc
agccccggctgccttgcgcagatggtggcggcttatgaaaggctgggaggcaacctcctg
tgcacgcttgaaatccccatcgaccagacgtccagctatggcgtggtcgatccgggggaa
cgccatggcgccgtggtggagatcaagggcctggtcgaaaagcccgcgccgggcaccgcg
ccgtccaatctgatcctgcccggccgctatatcctccagccggagatcatgcaggtcctg
ggtcggcaggaaaaaggcgcgggcggcgaaatccagctcacggacgcgatggcggcgctg
atcggcagccagcctttcaacggcctgacctttgccggacagcggttcgactgcgggtcc
aaggcaggcttcatagaagcgaacctggccctggctctggatcgtgaagacattggcgat
catatattggcctacgcggccgatttgatcgcaactattcagaagggcagggggctgtcc
cgcgacgtagcctga

DBGET integrated database retrieval system