KEGG   Sphingobium chlorophenolicum: Sphch_0493Help
Entry
Sphch_0493        CDS       T01522                                 

Definition
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sphch_0493
   00052 Galactose metabolism
    Sphch_0493
   00500 Starch and sucrose metabolism
    Sphch_0493
   00520 Amino sugar and nucleotide sugar metabolism
    Sphch_0493
Enzymes [BR:sch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sphch_0493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:519406..520320
Genome map
AA seq 304 aa AA seqDB search
MWGYMRPIKKAVFPVAGLGTRFLPATKVVPKELLAIIDRPLLQYAVDEAIEAGIEQFIFV
TGRGKGAIEDYFDMAFELETTQIGRGKDISALHGTRMQPGQAVFLRQQEPLGLGHAIWCA
RHIVGDEPFAVLLPDEFMYGSPGCLAQMVAAYERLGGNLLCTLEIPIDQTSSYGVVDPGE
RHGAVVEIKGLVEKPAPGTAPSNLILPGRYILQPEIMQVLGRQEKGAGGEIQLTDAMAAL
IGSQPFNGLTFAGQRFDCGSKAGFIEANLALALDREDIGDHILAYAADLIATIQKGRGLS
RDVA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtgggggtatatgcgaccgatcaagaaagccgttttccccgttgccggactcggaacg
cgatttctgccggcgacgaaggtcgtgccgaaggaattgctggcgattattgaccgtccc
ctgctgcaatatgcggtggacgaagcgatagaggcggggatcgagcagttcatcttcgtg
acgggccgggggaagggcgcgatcgaggattacttcgacatggcgttcgaactggaaacg
acccagatcggccggggcaaggatatttcggcgctgcatggcacgcgcatgcaacccggc
caggccgtcttcctccgtcagcaggaaccgctgggcttgggtcatgccatctggtgcgcg
cggcacattgtcggggacgagcctttcgccgtcctcttgcccgatgaattcatgtatggc
agccccggctgccttgcgcagatggtggcggcttatgaaaggctgggaggcaacctcctg
tgcacgcttgaaatccccatcgaccagacgtccagctatggcgtggtcgatccgggggaa
cgccatggcgccgtggtggagatcaagggcctggtcgaaaagcccgcgccgggcaccgcg
ccgtccaatctgatcctgcccggccgctatatcctccagccggagatcatgcaggtcctg
ggtcggcaggaaaaaggcgcgggcggcgaaatccagctcacggacgcgatggcggcgctg
atcggcagccagcctttcaacggcctgacctttgccggacagcggttcgactgcgggtcc
aaggcaggcttcatagaagcgaacctggccctggctctggatcgtgaagacattggcgat
catatattggcctacgcggccgatttgatcgcaactattcagaagggcagggggctgtcc
cgcgacgtagcctga

DBGET integrated database retrieval system