KEGG   Sphingobium chlorophenolicum: Sphch_0585Help
Entry
Sphch_0585        CDS       T01522                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sphch_0585
Enzymes [BR:sch01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Sphch_0585
Exosome [BR:sch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sphch_0585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:617532..619694
Genome map
AA seq 720 aa AA seqDB search
MGLTPEQIARLLEGREDDPFATLGVHPAGKGFTACVLLPEAVSVTAYRLDGKAVGALDRI
DPAGLFFGRLSIRKRQPLRYHATYADGGEYSLIDPYSFGPVLGPMDDHYFAEGSHARLFD
KMGAHIITHEGVEGTHFAVWAPNARRVSVVGDFNRWDGRRGAMRRRQDSGVWEIFLPEVG
VGSAYKFEIVGPDGVVLPLKADPFAFQSELRPATASIVAAVPDHVWGDERHRAHWQKADA
RREPISIYEVHAGSWQRDDAGNFLTWDELANRLIPYVVGMGFTHIEFLPISEFPYDPSWG
YQTTGLYAPTARFGDPEGFARFVDGAHRAGVGVILDWVPAHFPTDAHGLARFDGTALYEH
ADPRKGFHPDWNTAIYNFGRREVAQYLANNALFWAERYHVDGLRVDAVASMLYLDYSRKE
GEWIPNQHGGRENVEAVEFLQQMNKALYGAQAGIMTIAEESTSWPKVSHPVHEGGLGFGF
KWNMGFMHDTLRYLTRDPVHRAHHHDDITFGLLYAFTENFVLALSHDEVVHGKSSLLHKM
AGDDWQKFATLRAYYAMMWGYPGKKLLFMGQEFAQREEWSEERALDWHLLDHRLHQGVQL
LVGDLNRLYRSHPALHARDCEVEGFEWVLVDAAADSVFAWVRRAPGAPPVVVISHFTPQL
RQGYRMRLPSGGRWREIMNSDALDYGGSGAGNMGFVTADEEGWANVTIPPFGTLMLELDY
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
gtgggtttgacgccggaacagatcgcccggctgctggaaggacgcgaggacgatcctttc
gcgacgcttggcgtccatccggctggaaagggcttcaccgcctgcgtcctgctgcccgaa
gcggtcagcgtcacggcgtaccggctggacggcaaggcggtgggcgccctggaccggatc
gatccggcggggctgttcttcggcaggctgtccatccgcaagcgccagccgctgcgctat
cacgccacctatgccgacggcggcgaatatagtctgatcgatccctacagcttcggcccg
gtgctggggccgatggatgatcattatttcgccgaaggatcgcacgcccggctgttcgac
aagatgggcgcacacatcatcacccatgaaggggtggagggcacgcatttcgcggtctgg
gcgcccaatgccaggcgcgtgtcggtggtgggcgacttcaaccgctgggacggccgccgg
ggggcgatgcggcggcggcaggattcgggggtgtgggaaatcttcctgcccgaagttggg
gtgggcagcgcctataagttcgagattgtcgggcccgacggcgtggtcctgccgctcaag
gccgatcccttcgccttccagtccgaattgcggcccgccaccgcctccatcgtggcggcg
gtgccggatcatgtctggggcgacgagcgccaccgcgcccattggcagaaggccgatgcg
cggcgcgagcccatatccatctacgaagtccatgccgggtcgtggcagcgcgacgatgcg
gggaatttcctcacctgggatgaactggccaaccggctgattccctatgtggtcggcatg
ggtttcacccatatcgaatttctgccgatcagcgaatttccctatgatcctagctgggga
tatcagaccaccggcctttatgcccccaccgcccgcttcggcgatccggaggggtttgcg
cggttcgtggatggggcgcaccgggcgggggtgggggtcatcctcgactgggtgccggcg
cattttccgaccgacgcccatgggctggcgcgtttcgatgggacggcgctttatgagcat
gccgatccgcgcaagggttttcaccccgactggaacaccgccatctataatttcggtcgg
cgggaggtggcgcaatatctggccaataacgcgcttttctgggcggagcgttatcatgtc
gacgggctgcgggtcgatgccgtcgcgtccatgctctacctggattacagtcgtaaggaa
ggggagtggattcccaaccagcatggcgggcgggagaatgtggaggcggtcgaattcctc
cagcagatgaacaaggcgctctacggcgcgcaggccggcatcatgaccattgccgaagag
tccacgagctggcccaaggtttcccacccggtgcatgaaggcgggctgggcttcggcttc
aaatggaatatgggcttcatgcacgacacgctgcgttatctgacgcgtgatccggtgcat
cgcgcccatcatcatgacgacatcactttcggcctgctctacgcctttaccgagaatttc
gtgctggcgctgagccatgacgaggtggtgcatggcaagtcatccctgctgcacaagatg
gccggggacgactggcagaaattcgccacgctgcgcgcctattatgcgatgatgtggggc
tatcccggcaagaagctgctgttcatggggcaggaattcgcccagcgcgaggaatggagc
gaggaacgggcgctcgactggcacctgctggatcacaggctgcatcagggcgtgcaattg
ctggtgggcgacctcaaccggctttatcgttcgcatcccgccctccatgcccgcgattgc
gaggtggaggggttcgaatgggtgctggtcgacgcggcggcggattcggtcttcgcctgg
gtccggcgcgctcccggtgcgccgccggtcgtcgtcatcagccatttcacgccgcaattg
cgccagggataccgcatgcgcctgccgtcgggcgggcgctggcgggagatcatgaacagc
gacgcgctggactatggcggcagcggcgcgggcaatatgggcttcgtcaccgccgatgag
gaaggatgggccaatgtcaccattccgcccttcggcacgttgatgctggaactggactat
tga

DBGET integrated database retrieval system