KEGG   Sphingobium chlorophenolicum: Sphch_0644Help
Entry
Sphch_0644        CDS       T01522                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sch01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sch00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:sch00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:682304..684463
Genome map
AA seq 719 aa AA seqDB search
MTSMTERAGLKVAPQLAAFIEERALPGTGVDAEAFWQGTAAIFAKFAPENAALLARRDAL
QAEIDAWHQERVGQPFDSAAYQGFLRQIDYLVPEPAPFQIGSENVDDEVARLAGPQLVVP
ILNARFLLNAANARWGSLYDALYGTDALPGAASGKGYDPARGAQVIAWAKAFLDRAVPLK
GHAGWADIVRLKVWNGELHLHIEDAHGVATSLDQTDGFVGYRGAPEDPTAILLRHNGLHI
ELVIDRSHPIGGGDPAGIADIILESALTTICDLEDSVAAVDADDKVAAYSNWLGLMQGNL
VDTFEKNGAMMTRALNPDRSYVAPKGGVFTLPGRSLLFVRNVGHLMTTPAVLLADGAQAP
EGIVDGIVTSLIALHDLKRAGGNSRAGSVYIVKPKMHGPEEVGFTNRLFDAIEDLLGLSR
HTLKVGVMDEERRTSANLAACIAAVKDRIVFINTGFLDRTGDEMHTSMRAGPMIRKGEMK
TSDWITAYEDRNVQIGLACGLSGRAQIGKGMWAAPDRMADMLDQKIGHPTSGANTAWVPS
PTAATLHATHYHSVDVFKRQDERAKEAIASLDKLLTIPVAQGRNWSEEEIAQELDNNAQG
ILGYVVRWIDQGVGCSKVPDIHDIGLMEDRATLRISSQHMANWLLHGVCTAEQVDAAFIR
MAAKVDAQNAGDPLYTPMSGNPEGLAWQAARALVFEGVSQPNGYTEPLLHKYRALAKAL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcatgacagagcgcgcaggcctgaaggtcgcgccgcaactcgccgccttcatc
gaggagcgcgcgcttccgggtactggcgtagacgccgaagcattctggcagggcactgcc
gcgatcttcgcgaaattcgccccggaaaacgccgccctgctcgccaggcgcgacgcgctc
caggcggagatcgacgcctggcatcaggaaagggtggggcagcccttcgacagcgcggcc
tatcagggcttcctgcgccagatcgactatctcgtcccagaacccgcgccgttccagatc
ggcagcgagaatgtcgacgatgaagtcgcccgtctggccgggccgcaactcgtcgtcccc
atcctcaacgcccgtttcctgctgaacgccgccaatgcacgctggggcagcctgtacgac
gcgctttatggcacggacgcgctgcccggcgcggcgtctggcaaggggtacgacccggcg
cgcggcgcgcaggtcatcgcctgggccaaggcatttctggaccgcgccgtcccgctgaag
gggcatgcgggctgggccgacatcgtccggctaaaagtctggaacggcgaacttcacttg
catatcgaggacgcgcacggcgtcgcgaccagcttggaccagacagatggcttcgtcggc
tatcgcggcgctccggaagatcccacggcgatcctgctgcgtcataatggcctgcatatc
gaactggtgatcgaccgttcccaccccattggcggcggcgatccggcaggcatagccgac
atcatcctggaatccgcgctcaccaccatctgcgatctggaggactcggtcgccgccgtc
gacgcggatgacaaggtcgccgcctattccaactggctgggcctgatgcagggcaatctt
gtcgacacgttcgagaagaacggcgcgatgatgacccgcgccctcaaccccgaccgcagc
tatgtcgcgcccaagggcggcgtcttcaccctgccggggcgcagcctgctgttcgtccgc
aatgtcggccatctgatgaccacgcccgccgtcctgctcgccgatggcgcgcaagccccc
gaaggcatagtcgacggcatcgtcaccagcctgatcgccctgcacgacctgaagcgggca
gggggcaacagccgtgccggaagcgtctatatcgtcaagcccaagatgcacgggccggag
gaagtcggcttcaccaaccgcctgttcgacgcgatagaggatctgctgggcctcagccgc
catacgctgaaggtcggcgtcatggacgaggaacgccgcacctccgccaacctcgcggcc
tgcatcgcggcggtgaaggaccgcatcgtcttcatcaacaccggcttcctcgaccgcacg
ggcgatgagatgcacacgtccatgcgcgccggtcccatgatccgcaagggcgagatgaag
accagcgactggatcacggcctatgaggaccgcaatgtccagatcggcctcgcctgcggc
ctgtcgggccgcgcccagatcggcaagggcatgtgggccgcgccggaccgtatggccgac
atgctggaccagaagatcggccatcccaccagcggcgccaacacggcctgggttccgtcc
cccacggcggcgacgctgcatgcgactcactatcacagcgtcgacgtcttcaaacgccag
gatgagcgcgcgaaggaagccatcgcctccctcgataagctgctgacgatccccgtcgcc
caaggccgcaactggtcggaggaagaaattgcgcaggaactggacaataatgcgcagggc
atacttggctatgtcgtccgctggatcgatcagggcgtcggctgttccaaggttcccgac
atccacgacatcggcctgatggaagaccgcgccacgctgcgcatctcctctcagcatatg
gcgaactggctgctccacggcgtctgcacggcggaacaggtcgacgccgctttcatccgc
atggccgccaaggtcgacgcccagaatgcgggcgacccgctctacacgccgatgagcggc
aatccggaaggtctggcctggcaagccgcccgcgctttggtcttcgaaggcgtcagccag
cccaacggctataccgaacccctgctccacaaatacagagccttggcgaaggccctctaa

DBGET integrated database retrieval system