KEGG   Sphingobium chlorophenolicum: Sphch_0644Help
Entry
Sphch_0644        CDS       T01522                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sphch_0644
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sphch_0644
   00630 Glyoxylate and dicarboxylate metabolism
    Sphch_0644
Enzymes [BR:sch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sphch_0644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:682304..684463
Genome map
AA seq 719 aa AA seqDB search
MTSMTERAGLKVAPQLAAFIEERALPGTGVDAEAFWQGTAAIFAKFAPENAALLARRDAL
QAEIDAWHQERVGQPFDSAAYQGFLRQIDYLVPEPAPFQIGSENVDDEVARLAGPQLVVP
ILNARFLLNAANARWGSLYDALYGTDALPGAASGKGYDPARGAQVIAWAKAFLDRAVPLK
GHAGWADIVRLKVWNGELHLHIEDAHGVATSLDQTDGFVGYRGAPEDPTAILLRHNGLHI
ELVIDRSHPIGGGDPAGIADIILESALTTICDLEDSVAAVDADDKVAAYSNWLGLMQGNL
VDTFEKNGAMMTRALNPDRSYVAPKGGVFTLPGRSLLFVRNVGHLMTTPAVLLADGAQAP
EGIVDGIVTSLIALHDLKRAGGNSRAGSVYIVKPKMHGPEEVGFTNRLFDAIEDLLGLSR
HTLKVGVMDEERRTSANLAACIAAVKDRIVFINTGFLDRTGDEMHTSMRAGPMIRKGEMK
TSDWITAYEDRNVQIGLACGLSGRAQIGKGMWAAPDRMADMLDQKIGHPTSGANTAWVPS
PTAATLHATHYHSVDVFKRQDERAKEAIASLDKLLTIPVAQGRNWSEEEIAQELDNNAQG
ILGYVVRWIDQGVGCSKVPDIHDIGLMEDRATLRISSQHMANWLLHGVCTAEQVDAAFIR
MAAKVDAQNAGDPLYTPMSGNPEGLAWQAARALVFEGVSQPNGYTEPLLHKYRALAKAL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcatgacagagcgcgcaggcctgaaggtcgcgccgcaactcgccgccttcatc
gaggagcgcgcgcttccgggtactggcgtagacgccgaagcattctggcagggcactgcc
gcgatcttcgcgaaattcgccccggaaaacgccgccctgctcgccaggcgcgacgcgctc
caggcggagatcgacgcctggcatcaggaaagggtggggcagcccttcgacagcgcggcc
tatcagggcttcctgcgccagatcgactatctcgtcccagaacccgcgccgttccagatc
ggcagcgagaatgtcgacgatgaagtcgcccgtctggccgggccgcaactcgtcgtcccc
atcctcaacgcccgtttcctgctgaacgccgccaatgcacgctggggcagcctgtacgac
gcgctttatggcacggacgcgctgcccggcgcggcgtctggcaaggggtacgacccggcg
cgcggcgcgcaggtcatcgcctgggccaaggcatttctggaccgcgccgtcccgctgaag
gggcatgcgggctgggccgacatcgtccggctaaaagtctggaacggcgaacttcacttg
catatcgaggacgcgcacggcgtcgcgaccagcttggaccagacagatggcttcgtcggc
tatcgcggcgctccggaagatcccacggcgatcctgctgcgtcataatggcctgcatatc
gaactggtgatcgaccgttcccaccccattggcggcggcgatccggcaggcatagccgac
atcatcctggaatccgcgctcaccaccatctgcgatctggaggactcggtcgccgccgtc
gacgcggatgacaaggtcgccgcctattccaactggctgggcctgatgcagggcaatctt
gtcgacacgttcgagaagaacggcgcgatgatgacccgcgccctcaaccccgaccgcagc
tatgtcgcgcccaagggcggcgtcttcaccctgccggggcgcagcctgctgttcgtccgc
aatgtcggccatctgatgaccacgcccgccgtcctgctcgccgatggcgcgcaagccccc
gaaggcatagtcgacggcatcgtcaccagcctgatcgccctgcacgacctgaagcgggca
gggggcaacagccgtgccggaagcgtctatatcgtcaagcccaagatgcacgggccggag
gaagtcggcttcaccaaccgcctgttcgacgcgatagaggatctgctgggcctcagccgc
catacgctgaaggtcggcgtcatggacgaggaacgccgcacctccgccaacctcgcggcc
tgcatcgcggcggtgaaggaccgcatcgtcttcatcaacaccggcttcctcgaccgcacg
ggcgatgagatgcacacgtccatgcgcgccggtcccatgatccgcaagggcgagatgaag
accagcgactggatcacggcctatgaggaccgcaatgtccagatcggcctcgcctgcggc
ctgtcgggccgcgcccagatcggcaagggcatgtgggccgcgccggaccgtatggccgac
atgctggaccagaagatcggccatcccaccagcggcgccaacacggcctgggttccgtcc
cccacggcggcgacgctgcatgcgactcactatcacagcgtcgacgtcttcaaacgccag
gatgagcgcgcgaaggaagccatcgcctccctcgataagctgctgacgatccccgtcgcc
caaggccgcaactggtcggaggaagaaattgcgcaggaactggacaataatgcgcagggc
atacttggctatgtcgtccgctggatcgatcagggcgtcggctgttccaaggttcccgac
atccacgacatcggcctgatggaagaccgcgccacgctgcgcatctcctctcagcatatg
gcgaactggctgctccacggcgtctgcacggcggaacaggtcgacgccgctttcatccgc
atggccgccaaggtcgacgcccagaatgcgggcgacccgctctacacgccgatgagcggc
aatccggaaggtctggcctggcaagccgcccgcgctttggtcttcgaaggcgtcagccag
cccaacggctataccgaacccctgctccacaaatacagagccttggcgaaggccctctaa

DBGET integrated database retrieval system